KEGG   Mus musculus (mouse): 12995Help
Entry
12995             CDS       T01002                                 

Gene name
Csnk2a1, Csnk2a1-rs4
Definition
(RefSeq) casein kinase 2, alpha 1 polypeptide (EC:2.7.11.1)
  KO
K03097  
casein kinase II subunit alpha [EC:2.7.11.1]
Organism
mmu  Mus musculus (mouse)
Pathway
Ribosome biogenesis in eukaryotes
NF-kappa B signaling pathway
Wnt signaling pathway
Adherens junction
Tight junction
Measles
Herpes simplex infection
Epstein-Barr virus infection
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Genetic Information Processing
  Translation
   03008 Ribosome biogenesis in eukaryotes
    12995 (Csnk2a1)
 Environmental Information Processing
  Signal transduction
   04310 Wnt signaling pathway
    12995 (Csnk2a1)
   04064 NF-kappa B signaling pathway
    12995 (Csnk2a1)
 Cellular Processes
  Cellular commiunity
   04520 Adherens junction
    12995 (Csnk2a1)
   04530 Tight junction
    12995 (Csnk2a1)
 Human Diseases
  Infectious diseases
   05162 Measles
    12995 (Csnk2a1)
   05168 Herpes simplex infection
    12995 (Csnk2a1)
   05169 Epstein-Barr virus infection
    12995 (Csnk2a1)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     12995 (Csnk2a1)
Protein kinases [BR:mmu01001]
 Serine/threonine protein kinases: Other group
  CK2 family
   12995 (Csnk2a1)
Ribosome biogenesis [BR:mmu03009]
 Eukaryotic Type
  90S particles
   Kinase
    12995 (Csnk2a1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
2; 2 G3
AA seq 391 aa AA seqDB search
MSGPVPSRARVYTDVNTHRPREYWDYESHVVEWGNQDDYQLVRKLGRGKYSEVFEAINIT
NNEKVVVKILKPVKKKKIKREIKILENLRGGPNIITLADIVKDPVSRTPALVFEHVNNTD
FKQLYQTLTDYDIRFYMYEILKALDYCHSMGIMHRDVKPHNVMIDHEHRKLRLIDWGLAE
FYHPGQEYNVRVASRYFKGPELLVDYQMYDYSLDMWSLGCMLASMIFRKEPFFHGHDNYD
QLVRIAKVLGTEDLYDYIDKYNIELDPRFNDILGRHSRKRWERFVHSENQHLVSPEALDF
LDKLLRYDHQSRLTAREAMEHPYFYTVVKDQARMSSTSMAGGSTPVSSANMMSGISSVPT
PSPLGPLAGSPVIAAANSLGIPVPAAAGAQQ
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgtcgggacccgtgccaagcagggccagagtttacacagatgttaacacacacagaccc
cgagagtactgggattatgaatcacatgtggtggaatgggggaatcaagatgactatcag
cttgttcgaaaattaggtaggggcaaatacagtgaagtgtttgaagccatcaacatcaca
aataatgaaaaagttgttgttaaaattctcaagccagtaaaaaagaagaaaattaagcgt
gaaataaagattttggagaatttgagaggtgggcccaacatcatcacacttgcagacatt
gtaaaagaccctgtgtcacgaacccctgccttggtttttgaacatgtaaacaacacagac
ttcaagcaattgtaccagacgttaacagactatgacattcgattttacatgtatgaaatt
ctgaaagccctggattattgtcacagcatggggattatgcacagagatgtgaaaccccat
aatgtcatgattgatcatgagcacagaaagcttcggctaatagactggggtttagctgag
ttttaccatccaggccaagagtataatgtccgagttgcttctcgatatttcaaaggtcca
gagctacttgtagattatcagatgtacgattatagtttggatatgtggagcttgggttgt
atgctggccagtatgatcttccggaaggagccatttttccatggacatgacaattatgat
cagttggtgaggatagccaaggttctgggaacagaagatttatatgactatattgacaag
tacaacattgaattagatccacgtttcaacgatatcttgggcagacactcccgtaagcga
tgggaacgctttgtccacagtgaaaaccagcatcttgtcagccctgaggccttggatttt
ctggacaagctgcttcgatatgaccaccagtcacggctcactgcaagagaggccatggag
cacccttacttctacactgttgtgaaggaccaggctcgaatgagttccactagcatggca
gggggcagcacacctgtcagcagcgccaatatgatgtcagggatttcttcagtgccaact
ccttcaccccttggacctctggcaggctcaccagtgattgccgctgccaactcacttggg
atacctgttccagctgctgctggcgctcagcagtaa

DBGET integrated database retrieval system