KEGG   Mus musculus (mouse): 12995Help
Entry
12995             CDS       T01002                                 

Gene name
Csnk2a1, Csnk2a1-rs4
Definition
(RefSeq) casein kinase 2, alpha 1 polypeptide
  KO
K03097  casein kinase II subunit alpha [EC:2.7.11.1]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu03008  Ribosome biogenesis in eukaryotes
mmu04064  NF-kappa B signaling pathway
mmu04137  Mitophagy - animal
mmu04310  Wnt signaling pathway
mmu04520  Adherens junction
mmu05162  Measles
mmu05168  Herpes simplex infection
mmu05169  Epstein-Barr virus infection
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Genetic Information Processing
  Translation
   03008 Ribosome biogenesis in eukaryotes
    12995 (Csnk2a1)
 Environmental Information Processing
  Signal transduction
   04310 Wnt signaling pathway
    12995 (Csnk2a1)
   04064 NF-kappa B signaling pathway
    12995 (Csnk2a1)
 Cellular Processes
  Transport and catabolism
   04137 Mitophagy - animal
    12995 (Csnk2a1)
  Cellular community - eukaryotes
   04520 Adherens junction
    12995 (Csnk2a1)
 Human Diseases
  Infectious diseases
   05162 Measles
    12995 (Csnk2a1)
   05168 Herpes simplex infection
    12995 (Csnk2a1)
   05169 Epstein-Barr virus infection
    12995 (Csnk2a1)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     12995 (Csnk2a1)
Protein kinases [BR:mmu01001]
 Serine/threonine kinases: Other
  CK2 family
   12995 (Csnk2a1)
Ribosome biogenesis [BR:mmu03009]
 Eukaryotic Type
  90S particles
   Kinase
    12995 (Csnk2a1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr APH Kdo Kinase-like Choline_kinase ABC1
Motif
Other DBs
NCBI-GeneID: 12995
NCBI-ProteinID: NP_031814
MGI: 88543
Ensembl: ENSMUSG00000074698
Vega: OTTMUSG00000015858
UniProt: Q60737
Position
2; 2 G3
AA seq 391 aa AA seqDB search
MSGPVPSRARVYTDVNTHRPREYWDYESHVVEWGNQDDYQLVRKLGRGKYSEVFEAINIT
NNEKVVVKILKPVKKKKIKREIKILENLRGGPNIITLADIVKDPVSRTPALVFEHVNNTD
FKQLYQTLTDYDIRFYMYEILKALDYCHSMGIMHRDVKPHNVMIDHEHRKLRLIDWGLAE
FYHPGQEYNVRVASRYFKGPELLVDYQMYDYSLDMWSLGCMLASMIFRKEPFFHGHDNYD
QLVRIAKVLGTEDLYDYIDKYNIELDPRFNDILGRHSRKRWERFVHSENQHLVSPEALDF
LDKLLRYDHQSRLTAREAMEHPYFYTVVKDQARMSSTSMAGGSTPVSSANMMSGISSVPT
PSPLGPLAGSPVIAAANSLGIPVPAAAGAQQ
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgtcgggacccgtgccaagcagggccagagtttacacagatgttaacacacacagaccc
cgagagtactgggattatgaatcacatgtggtggaatgggggaatcaagatgactatcag
cttgttcgaaaattaggtaggggcaaatacagtgaagtgtttgaagccatcaacatcaca
aataatgaaaaagttgttgttaaaattctcaagccagtaaaaaagaagaaaattaagcgt
gaaataaagattttggagaatttgagaggtgggcccaacatcatcacacttgcagacatt
gtaaaagaccctgtgtcacgaacccctgccttggtttttgaacatgtaaacaacacagac
ttcaagcaattgtaccagacgttaacagactatgacattcgattttacatgtatgaaatt
ctgaaagccctggattattgtcacagcatggggattatgcacagagatgtgaaaccccat
aatgtcatgattgatcatgagcacagaaagcttcggctaatagactggggtttagctgag
ttttaccatccaggccaagagtataatgtccgagttgcttctcgatatttcaaaggtcca
gagctacttgtagattatcagatgtacgattatagtttggatatgtggagcttgggttgt
atgctggccagtatgatcttccggaaggagccatttttccatggacatgacaattatgat
cagttggtgaggatagccaaggttctgggaacagaagatttatatgactatattgacaag
tacaacattgaattagatccacgtttcaacgatatcttgggcagacactcccgtaagcga
tgggaacgctttgtccacagtgaaaaccagcatcttgtcagccctgaggccttggatttt
ctggacaagctgcttcgatatgaccaccagtcacggctcactgcaagagaggccatggag
cacccttacttctacactgttgtgaaggaccaggctcgaatgagttccactagcatggca
gggggcagcacacctgtcagcagcgccaatatgatgtcagggatttcttcagtgccaact
ccttcaccccttggacctctggcaggctcaccagtgattgccgctgccaactcacttggg
atacctgttccagctgctgctggcgctcagcagtaa

DBGET integrated database retrieval system