KEGG   Mus musculus (mouse): 13001Help
Entry
13001             CDS       T01002                                 

Gene name
Csnk2b, CK_II_beta
Definition
(RefSeq) casein kinase 2, beta polypeptide
  KO
K03115  
casein kinase II subunit beta
Organism
mmu  Mus musculus (mouse)
Pathway
Ribosome biogenesis in eukaryotes
NF-kappa B signaling pathway
Wnt signaling pathway
Adherens junction
Measles
Herpes simplex infection
Epstein-Barr virus infection
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Genetic Information Processing
  Translation
   03008 Ribosome biogenesis in eukaryotes
    13001 (Csnk2b)
 Environmental Information Processing
  Signal transduction
   04310 Wnt signaling pathway
    13001 (Csnk2b)
   04064 NF-kappa B signaling pathway
    13001 (Csnk2b)
 Cellular Processes
  Cellular community - eukaryotes
   04520 Adherens junction
    13001 (Csnk2b)
 Human Diseases
  Infectious diseases
   05162 Measles
    13001 (Csnk2b)
   05168 Herpes simplex infection
    13001 (Csnk2b)
   05169 Epstein-Barr virus infection
    13001 (Csnk2b)
Ribosome biogenesis [BR:mmu03009]
 Eukaryotic Type
  90S particles
   Kinase
    13001 (Csnk2b)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
17 B1; 17 18.59 cM
AA seq 215 aa AA seqDB search
MSSSEEVSWISWFCGLRGNEFFCEVDEDYIQDKFNLTGLNEQVPHYRQALDMILDLEPDE
ELEDNPNQSDLIEQAAEMLYGLIHARYILTNRGIAQMLEKYQQGDFGYCPRVYCENQPML
PIGLSDIPGEAMVKLYCPKCMDVYTPKSSRHHHTDGAYFGTGFPHMLFMVHPEYRPKRPA
NQFVPRLYGFKIHPMAYQLQLQAASNFKSPVKTIR
NT seq 648 nt NT seq  +upstreamnt  +downstreamnt
atgagtagctctgaggaggtgtcctggatttcctggttctgtgggctccgtggtaatgaa
ttcttctgtgaggtggatgaagactacatccaggacaaatttaatcttactggactcaat
gagcaggtgcctcactatcgacaagctctggacatgatcttagacctggaacctgatgaa
gagctggaagacaaccccaaccagagcgacttgatcgaacaggcagctgagatgctttat
gggttgatccacgcccgctacatcctcaccaaccgaggcatcgcacaaatgttggaaaag
taccagcagggagactttggctactgtcctcgtgtatactgtgagaaccagccaatgctt
cctatcggcctttcagacatcccaggcgaggccatggtgaaactctactgccccaagtgc
atggacgtgtacacacccaagtcctccagacaccaccacacggacggcgcatacttcggc
actggtttccctcacatgctcttcatggtgcatccagagtaccggcccaagcgacctgcc
aaccagtttgtacccaggctctatggtttcaagatccatccaatggcttaccagctgcag
ctccaagccgccagcaacttcaagagcccagtcaagactattcgctga

DBGET integrated database retrieval system