KEGG   Mus musculus (mouse): 13001Help
Entry
13001             CDS       T01002                                 

Gene name
Csnk2b, CK_II_beta
Definition
(RefSeq) casein kinase 2, beta polypeptide (EC:2.7.11.1)
  KO
K03115  
casein kinase II subunit beta
Organism
mmu  Mus musculus (mouse)
Pathway
Ribosome biogenesis in eukaryotes
NF-kappa B signaling pathway
Wnt signaling pathway
Adherens junction
Tight junction
Measles
Herpes simplex infection
Epstein-Barr virus infection
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Genetic Information Processing
  Translation
   03008 Ribosome biogenesis in eukaryotes
    13001 (Csnk2b)
 Environmental Information Processing
  Signal transduction
   04310 Wnt signaling pathway
    13001 (Csnk2b)
   04064 NF-kappa B signaling pathway
    13001 (Csnk2b)
 Cellular Processes
  Cellular commiunity
   04520 Adherens junction
    13001 (Csnk2b)
   04530 Tight junction
    13001 (Csnk2b)
 Human Diseases
  Infectious diseases
   05162 Measles
    13001 (Csnk2b)
   05168 Herpes simplex infection
    13001 (Csnk2b)
   05169 Epstein-Barr virus infection
    13001 (Csnk2b)
Ribosome biogenesis [BR:mmu03009]
 Eukaryotic Type
  90S particles
   Kinase
    13001 (Csnk2b)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
17 B1; 17 18.59 cM
AA seq 215 aa AA seqDB search
MSSSEEVSWISWFCGLRGNEFFCEVDEDYIQDKFNLTGLNEQVPHYRQALDMILDLEPDE
ELEDNPNQSDLIEQAAEMLYGLIHARYILTNRGIAQMLEKYQQGDFGYCPRVYCENQPML
PIGLSDIPGEAMVKLYCPKCMDVYTPKSSRHHHTDGAYFGTGFPHMLFMVHPEYRPKRPA
NQFVPRLYGFKIHPMAYQLQLQAASNFKSPVKTIR
NT seq 648 nt NT seq  +upstreamnt  +downstreamnt
atgagtagctctgaggaggtgtcctggatttcctggttctgtgggctccgtggtaatgaa
ttcttctgtgaggtggatgaagactacatccaggacaaatttaatcttactggactcaat
gagcaggtgcctcactatcgacaagctctggacatgatcttagacctggaacctgatgaa
gagctggaagacaaccccaaccagagcgacttgatcgaacaggcagctgagatgctttat
gggttgatccacgcccgctacatcctcaccaaccgaggcatcgcacaaatgttggaaaag
taccagcagggagactttggctactgtcctcgtgtatactgtgagaaccagccaatgctt
cctatcggcctttcagacatcccaggcgaggccatggtgaaactctactgccccaagtgc
atggacgtgtacacacccaagtcctccagacaccaccacacggacggcgcatacttcggc
actggtttccctcacatgctcttcatggtgcatccagagtaccggcccaagcgacctgcc
aaccagtttgtacccaggctctatggtttcaagatccatccaatggcttaccagctgcag
ctccaagccgccagcaacttcaagagcccagtcaagactattcgctga

DBGET integrated database retrieval system