KEGG   Mus musculus (mouse): 13001Help
Entry
13001             CDS       T01002                                 

Gene name
Csnk2b, CK_II_beta
Definition
(RefSeq) casein kinase 2, beta polypeptide
  KO
K03115  casein kinase II subunit beta
Organism
mmu  Mus musculus (mouse)
Pathway
mmu03008  Ribosome biogenesis in eukaryotes
mmu04064  NF-kappa B signaling pathway
mmu04137  Mitophagy - animal
mmu04310  Wnt signaling pathway
mmu04520  Adherens junction
mmu05162  Measles
mmu05168  Herpes simplex infection
mmu05169  Epstein-Barr virus infection
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Genetic Information Processing
  Translation
   03008 Ribosome biogenesis in eukaryotes
    13001 (Csnk2b)
 Environmental Information Processing
  Signal transduction
   04310 Wnt signaling pathway
    13001 (Csnk2b)
   04064 NF-kappa B signaling pathway
    13001 (Csnk2b)
 Cellular Processes
  Transport and catabolism
   04137 Mitophagy - animal
    13001 (Csnk2b)
  Cellular community - eukaryotes
   04520 Adherens junction
    13001 (Csnk2b)
 Human Diseases
  Infectious diseases
   05162 Measles
    13001 (Csnk2b)
   05168 Herpes simplex infection
    13001 (Csnk2b)
   05169 Epstein-Barr virus infection
    13001 (Csnk2b)
Ribosome biogenesis [BR:mmu03009]
 Eukaryotic Type
  90S particles
   Kinase
    13001 (Csnk2b)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CK_II_beta CCDC24
Motif
Other DBs
NCBI-GeneID: 13001
NCBI-ProteinID: NP_001290374
MGI: 88548
Ensembl: ENSMUSG00000024387
Vega: OTTMUSG00000037175
UniProt: P67871
Position
17 B1; 17 18.59 cM
AA seq 215 aa AA seqDB search
MSSSEEVSWISWFCGLRGNEFFCEVDEDYIQDKFNLTGLNEQVPHYRQALDMILDLEPDE
ELEDNPNQSDLIEQAAEMLYGLIHARYILTNRGIAQMLEKYQQGDFGYCPRVYCENQPML
PIGLSDIPGEAMVKLYCPKCMDVYTPKSSRHHHTDGAYFGTGFPHMLFMVHPEYRPKRPA
NQFVPRLYGFKIHPMAYQLQLQAASNFKSPVKTIR
NT seq 648 nt NT seq  +upstreamnt  +downstreamnt
atgagtagctctgaggaggtgtcctggatttcctggttctgtgggctccgtggtaatgaa
ttcttctgtgaggtggatgaagactacatccaggacaaatttaatcttactggactcaat
gagcaggtgcctcactatcgacaagctctggacatgatcttagacctggaacctgatgaa
gagctggaagacaaccccaaccagagcgacttgatcgaacaggcagctgagatgctttat
gggttgatccacgcccgctacatcctcaccaaccgaggcatcgcacaaatgttggaaaag
taccagcagggagactttggctactgtcctcgtgtatactgtgagaaccagccaatgctt
cctatcggcctttcagacatcccaggcgaggccatggtgaaactctactgccccaagtgc
atggacgtgtacacacccaagtcctccagacaccaccacacggacggcgcatacttcggc
actggtttccctcacatgctcttcatggtgcatccagagtaccggcccaagcgacctgcc
aaccagtttgtacccaggctctatggtttcaagatccatccaatggcttaccagctgcag
ctccaagccgccagcaacttcaagagcccagtcaagactattcgctga

DBGET integrated database retrieval system