KEGG   Mus musculus (mouse): 13030Help
Entry
13030             CDS       T01002                                 

Gene name
Ctsb, CB
Definition
(RefSeq) cathepsin B (EC:3.4.22.1)
  KO
K01363  
cathepsin B [EC:3.4.22.1]
Organism
mmu  Mus musculus (mouse)
Pathway
Lysosome
Apoptosis
Antigen processing and presentation
Renin secretion
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Cellular Processes
  Transport and catabolism
   04142 Lysosome
    13030 (Ctsb)
  Cell growth and death
   04210 Apoptosis
    13030 (Ctsb)
 Organismal Systems
  Immune system
   04612 Antigen processing and presentation
    13030 (Ctsb)
  Endocrine system
   04924 Renin secretion
    13030 (Ctsb)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.1  cathepsin B
     13030 (Ctsb)
Peptidases [BR:mmu01002]
 Cysteine Peptidases
  Family C1: papain family
   13030 (Ctsb)
Chaperones and folding catalysts [BR:mmu03110]
 Intramolecular chaperones
  Papain family
   13030 (Ctsb)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of microglial cells
   13030 (Ctsb)
Glycosaminoglycan binding proteins [BR:mmu00536]
 Heparan sulfate/Haparin
  Others
   13030 (Ctsb)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
UniProt: 
Position
14 D1; 14 33.24 cM
AA seq 339 aa AA seqDB search
MWWSLILLSCLLALTSAHDKPSFHPLSDDLINYINKQNTTWQAGRNFYNVDISYLKKLCG
TVLGGPKLPGRVAFGEDIDLPETFDAREQWSNCPTIGQIRDQGSCGSCWAFGAVEAISDR
TCIHTNGRVNVEVSAEDLLTCCGIQCGDGCNGGYPSGAWSFWTKKGLVSGGVYNSHVGCL
PYTIPPCEHHVNGSRPPCTGEGDTPRCNKSCEAGYSPSYKEDKHFGYTSYSVSNSVKEIM
AEIYKNGPVEGAFTVFSDFLTYKSGVYKHEAGDMMGGHAIRILGWGVENGVPYWLAANSW
NLDWGDNGFFKILRGENHCGIESEIVAGIPRTDQYWGRF
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
atgtggtggtccttgatccttctttcttgcctgctggcactgaccagtgcccatgacaag
ccttccttccacccgctgtcggatgacctgattaactatatcaacaaacagaatacaaca
tggcaggctggacgcaacttctacaatgttgacataagctatctgaagaagctgtgtggc
actgtcctgggtggacccaaactgccaggaagggttgcgttcggtgaggacatagatcta
cctgaaacctttgatgcacgggaacaatggtccaactgcccgaccattggacagattaga
gaccagggctcctgcggctcttgttgggcatttggggcagtggaagccatttctgaccga
acctgcattcacaccaatggccgagtcaacgtggaggtgtctgctgaagacctgcttact
tgctgtggtatccagtgtggggacggctgtaatggtggctatccctctggagcatggagc
ttctggacaaaaaaaggcctggtttcaggtggagtctacaattctcatgtaggctgctta
ccatacaccatccctccctgcgagcaccatgtcaatggctcccgtcccccatgcactgga
gaaggagatactcccaggtgcaacaagagctgtgaagctggctactccccatcctacaaa
gaggataagcactttgggtacacttcctacagcgtgtctaacagtgtgaaggagatcatg
gcagaaatctacaaaaatggcccagtggagggtgccttcactgtgttttctgacttcttg
acttacaaatcaggagtatacaagcatgaagccggtgatatgatgggtggccacgccatc
cgcatcctgggctggggagtagagaatggagttccctactggctggcagccaactcttgg
aaccttgactggggtgataatggcttctttaaaatcctcagaggagagaaccactgtggc
attgaatcagaaattgtggctggaatcccacgcactgaccagtactggggaagattctaa

DBGET integrated database retrieval system