KEGG   Mus musculus (mouse): 13030Help
Entry
13030             CDS       T01002                                 

Gene name
Ctsb, CB
Definition
(RefSeq) cathepsin B
  KO
K01363  
cathepsin B [EC:3.4.22.1]
Organism
mmu  Mus musculus (mouse)
Pathway
Autophagy - animal
Lysosome
Apoptosis
Antigen processing and presentation
NOD-like receptor signaling pathway
Renin secretion
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Cellular Processes
  Transport and catabolism
   04142 Lysosome
    13030 (Ctsb)
   04140 Autophagy - animal
    13030 (Ctsb)
  Cell growth and death
   04210 Apoptosis
    13030 (Ctsb)
 Organismal Systems
  Immune system
   04621 NOD-like receptor signaling pathway
    13030 (Ctsb)
   04612 Antigen processing and presentation
    13030 (Ctsb)
  Endocrine system
   04924 Renin secretion
    13030 (Ctsb)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.1  cathepsin B
     13030 (Ctsb)
Peptidases [BR:mmu01002]
 Cysteine Peptidases
  Family C1: papain family
   13030 (Ctsb)
Chaperones and folding catalysts [BR:mmu03110]
 Intramolecular chaperones
  Papain family
   13030 (Ctsb)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of microglial cells
   13030 (Ctsb)
Glycosaminoglycan binding proteins [BR:mmu00536]
 Heparan sulfate/Haparin
  Others
   13030 (Ctsb)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
MGI: 
Ensembl: 
UniProt: 
Position
14 D1; 14 33.24 cM
AA seq 339 aa AA seqDB search
MWWSLILLSCLLALTSAHDKPSFHPLSDDLINYINKQNTTWQAGRNFYNVDISYLKKLCG
TVLGGPKLPGRVAFGEDIDLPETFDAREQWSNCPTIGQIRDQGSCGSCWAFGAVEAISDR
TCIHTNGRVNVEVSAEDLLTCCGIQCGDGCNGGYPSGAWSFWTKKGLVSGGVYNSHVGCL
PYTIPPCEHHVNGSRPPCTGEGDTPRCNKSCEAGYSPSYKEDKHFGYTSYSVSNSVKEIM
AEIYKNGPVEGAFTVFSDFLTYKSGVYKHEAGDMMGGHAIRILGWGVENGVPYWLAANSW
NLDWGDNGFFKILRGENHCGIESEIVAGIPRTDQYWGRF
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
atgtggtggtccttgatccttctttcttgcctgctggcactgaccagtgcccatgacaag
ccttccttccacccgctgtcggatgacctgattaactatatcaacaaacagaatacaaca
tggcaggctggacgcaacttctacaatgttgacataagctatctgaagaagctgtgtggc
actgtcctgggtggacccaaactgccaggaagggttgcgttcggtgaggacatagatcta
cctgaaacctttgatgcacgggaacaatggtccaactgcccgaccattggacagattaga
gaccagggctcctgcggctcttgttgggcatttggggcagtggaagccatttctgaccga
acctgcattcacaccaatggccgagtcaacgtggaggtgtctgctgaagacctgcttact
tgctgtggtatccagtgtggggacggctgtaatggtggctatccctctggagcatggagc
ttctggacaaaaaaaggcctggtttcaggtggagtctacaattctcatgtaggctgctta
ccatacaccatccctccctgcgagcaccatgtcaatggctcccgtcccccatgcactgga
gaaggagatactcccaggtgcaacaagagctgtgaagctggctactccccatcctacaaa
gaggataagcactttgggtacacttcctacagcgtgtctaacagtgtgaaggagatcatg
gcagaaatctacaaaaatggcccagtggagggtgccttcactgtgttttctgacttcttg
acttacaaatcaggagtatacaagcatgaagccggtgatatgatgggtggccacgccatc
cgcatcctgggctggggagtagagaatggagttccctactggctggcagccaactcttgg
aaccttgactggggtgataatggcttctttaaaatcctcagaggagagaaccactgtggc
attgaatcagaaattgtggctggaatcccacgcactgaccagtactggggaagattctaa

DBGET integrated database retrieval system