KEGG   Mus musculus (mouse): 13032Help
Entry
13032             CDS       T01002                                 

Gene name
Ctsc, AI047818, CatC, DPP1, DPPI
Definition
(RefSeq) cathepsin C (EC:3.4.14.1)
  KO
K01275  
cathepsin C [EC:3.4.14.1]
Organism
mmu  Mus musculus (mouse)
Pathway
Lysosome
Apoptosis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Cellular Processes
  Transport and catabolism
   04142 Lysosome
    13032 (Ctsc)
  Cell growth and death
   04210 Apoptosis
    13032 (Ctsc)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.14  Dipeptidyl-peptidases and tripeptidyl-peptidases
    3.4.14.1  dipeptidyl-peptidase I
     13032 (Ctsc)
Peptidases [BR:mmu01002]
 Cysteine Peptidases
  Family C1: papain family
   13032 (Ctsc)
Chaperones and folding catalysts [BR:mmu03110]
 Intramolecular chaperones
  Papain family
   13032 (Ctsc)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   13032 (Ctsc)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
7; 7 D3-E1.1
AA seq 462 aa AA seqDB search
MGPWTHSLRAVLLLVLLGVCTVRSDTPANCTYPDLLGTWVFQVGPRSSRSDINCSVMEAT
EEKVVVHLKKLDTAYDELGNSGHFTLIYNQGFEIVLNDYKWFAFFKYEVRGHTAISYCHE
TMTGWVHDVLGRNWACFVGKKVESHIEKVNMNAAHLGGLQERYSERLYTHNHNFVKAINT
VQKSWTATAYKEYEKMSLRDLIRRSGHSQRIPRPKPAPMTDEIQQQILNLPESWDWRNVQ
GVNYVSPVRNQESCGSCYSFASMGMLEARIRILTNNSQTPILSPQEVVSCSPYAQGCDGG
FPYLIAGKYAQDFGVVEESCFPYTAKDSPCKPRENCLRYYSSDYYYVGGFYGGCNEALMK
LELVKHGPMAVAFEVHDDFLHYHSGIYHHTGLSDPFNPFELTNHAVLLVGYGRDPVTGIE
YWIIKNSWGSNWGESGYFRIRRGTDECAIESIAVAAIPIPKL
NT seq 1389 nt NT seq  +upstreamnt  +downstreamnt
atgggtccctggacccactccttgcgcgccgtcctgctgctggtgcttttgggagtctgc
accgtgcgctccgacactcctgccaactgcacctaccctgatctgctgggcacctgggtg
ttccaggtgggccctagaagttcccgaagcgacattaactgctcggtgatggaagcaaca
gaagaaaaggtagtggtacaccttaagaagttggatactgcctacgacgagctgggcaat
tccgggcattttaccctcatttacaaccaaggcttcgagattgtgttgaatgactacaaa
tggtttgcgtttttcaagtatgaagtcagaggccacacagctatcagttactgccatgag
accatgactgggtgggtccatgatgtgctgggccggaactgggcttgctttgttggcaag
aaggtggaaagtcacattgagaaggttaatatgaatgcagcacatcttggaggtctccag
gaaagatattctgaaagactctacactcacaaccacaactttgtgaaggccatcaatacc
gttcagaagtcttggactgcaactgcatataaggaatatgagaaaatgagcctgcgagat
ctgataaggagaagtggccacagccaaaggatcccaaggcccaaacctgccccgatgact
gatgaaatacagcaacaaattttaaatttgccagaatcttgggactggagaaacgtccaa
ggcgtcaattatgttagccctgttcgaaaccaagaatcttgtggaagctgctactcattt
gcctctatgggtatgctagaagcaagaattcgtatattaaccaacaattctcagacacca
atcctgagtcctcaggaggttgtatcttgcagcccctatgcccaaggttgtgatggtgga
ttcccatacctcattgcagggaagtatgcccaagattttggggtggtggaagaaagctgc
tttccctacacagccaaagattctccatgcaaaccaagggagaattgcctccgttactat
tcttctgactactactatgtgggtggtttctatggtggctgcaatgaagccctgatgaag
cttgagctggtcaaacatggacccatggcagttgcctttgaagtccacgatgacttccta
cactaccacagtggaatctatcaccacactgggctgagtgaccctttcaaccccttcgag
ctgacaaatcatgctgttttgcttgtgggctatggaagagatccagttactgggatagaa
tactggattataaagaacagctggggctctaactggggggagagtggctacttccgtatc
cgcagaggaactgatgaatgtgcaattgagagtatagccgtggcggccataccgattcct
aaattatag

DBGET integrated database retrieval system