KEGG   Mus musculus (mouse): 13040Help
Entry
13040             CDS       T01002                                 

Gene name
Ctss, Cats
Definition
(RefSeq) cathepsin S (EC:3.4.22.27)
  KO
K01368  
cathepsin S [EC:3.4.22.27]
Organism
mmu  Mus musculus (mouse)
Pathway
Lysosome
Phagosome
Apoptosis
Antigen processing and presentation
Tuberculosis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Cellular Processes
  Transport and catabolism
   04145 Phagosome
    13040 (Ctss)
   04142 Lysosome
    13040 (Ctss)
  Cell growth and death
   04210 Apoptosis
    13040 (Ctss)
 Organismal Systems
  Immune system
   04612 Antigen processing and presentation
    13040 (Ctss)
 Human Diseases
  Infectious diseases
   05152 Tuberculosis
    13040 (Ctss)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.27  cathepsin S
     13040 (Ctss)
Peptidases [BR:mmu01002]
 Cysteine Peptidases
  Family C1: papain family
   13040 (Ctss)
Chaperones and folding catalysts [BR:mmu03110]
 Intramolecular chaperones
  Papain family
   13040 (Ctss)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
3 F2.1; 3 40.74 cM
AA seq 340 aa AA seqDB search
MRAPGHAAIRWLFWMPLVCSVAMEQLQRDPTLDYHWDLWKKTHEKEYKDKNEEEVRRLIW
EKNLKFIMIHNLEYSMGMHTYQVGMNDMGDMTNEEILCRMGALRIPRQSPKTVTFRSYSN
RTLPDTVDWREKGCVTEVKYQGSCGACWAFSAVGALEGQLKLKTGKLISLSAQNLVDCSN
EEKYGNKGCGGGYMTEAFQYIIDNGGIEADASYPYKATDEKCHYNSKNRAATCSRYIQLP
FGDEDALKEAVATKGPVSVGIDASHSSFFFYKSGVYDDPSCTGNVNHGVLVVGYGTLDGK
DYWLVKNSWGLNFGDQGYIRMARNNKNHCGIASYCSYPEI
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atgagggctcctggccacgctgccataagatggctgttttggatgcccctggtgtgctct
gtggcaatggagcaactgcagagagaccctaccctggactaccattgggatctctggaag
aaaacccatgagaaagaatacaaggataagaatgaagaagaagtacggcgtctcatctgg
gaaaagaatctgaagtttataatgattcacaatctcgaatattctatgggaatgcatacc
taccaagtgggcatgaacgatatgggagacatgaccaatgaagaaatcttgtgtcggatg
ggtgctctgagaattccccgacagtctccgaagactgtcactttcaggtcatactctaat
cggacattgcctgacactgtggactggagagagaagggctgcgtcactgaggtgaaatac
cagggttcttgtggtgcctgctgggctttcagtgctgtgggggcccttgaagggcagctg
aagctgaaaacggggaagctgatatccctcagtgctcagaacctggtggactgctcaaat
gaagaaaagtatgggaataaaggctgtggaggcggctacatgaccgaagctttccagtac
atcattgataatgggggcatagaggcagacgcttcctatccctacaaagccacggatgaa
aagtgtcactataactcaaaaaatcgagctgccacgtgttcaaggtacattcagctcccg
tttggtgacgaggatgccctgaaagaagcagtggccactaaagggcctgtctctgtgggc
atcgacgccagccattcctccttcttcttctacaaaagcggtgtctatgacgacccctcc
tgtacgggcaatgtgaatcatggtgttcttgtggttggctatgggactcttgatggcaaa
gattactggcttgtgaaaaacagttggggccttaactttggtgatcaaggatacattcgg
atggcaagaaataataaaaatcactgcggaattgctagttattgctcttacccagaaatc
taa

DBGET integrated database retrieval system