KEGG   Mus musculus (mouse): 13067Help
Entry
13067             CDS       T01002                                 

Gene name
Cyct, T-Cc
Definition
cytochrome c, testis
Orthology
K08738  
cytochrome c
Organism
mmu  Mus musculus (mouse)
Pathway
Sulfur metabolism
p53 signaling pathway
Apoptosis
Non-alcoholic fatty liver disease (NAFLD)
Alzheimer's disease
Parkinson's disease
Amyotrophic lateral sclerosis (ALS)
Huntington's disease
Legionellosis
Toxoplasmosis
Tuberculosis
Hepatitis B
Influenza A
Herpes simplex infection
Pathways in cancer
Colorectal cancer
Small cell lung cancer
Viral myocarditis
Class
Metabolism; Energy metabolism; Sulfur metabolism [PATH:mmu00920]
Cellular Processes; Cell growth and death; Apoptosis [PATH:mmu04210]
Cellular Processes; Cell growth and death; p53 signaling pathway [PATH:mmu04115]
Human Diseases; Cancers; Pathways in cancer [PATH:mmu05200]
Human Diseases; Cancers; Colorectal cancer [PATH:mmu05210]
Human Diseases; Cancers; Small cell lung cancer [PATH:mmu05222]
Human Diseases; Neurodegenerative diseases; Alzheimer's disease [PATH:mmu05010]
Human Diseases; Neurodegenerative diseases; Parkinson's disease [PATH:mmu05012]
Human Diseases; Neurodegenerative diseases; Amyotrophic lateral sclerosis (ALS) [PATH:mmu05014]
Human Diseases; Neurodegenerative diseases; Huntington's disease [PATH:mmu05016]
Human Diseases; Cardiovascular diseases; Viral myocarditis [PATH:mmu05416]
Human Diseases; Endocrine and metabolic diseases; Non-alcoholic fatty liver disease (NAFLD) [PATH:mmu04932]
Human Diseases; Infectious diseases; Legionellosis [PATH:mmu05134]
Human Diseases; Infectious diseases; Tuberculosis [PATH:mmu05152]
Human Diseases; Infectious diseases; Influenza A [PATH:mmu05164]
Human Diseases; Infectious diseases; Hepatitis B [PATH:mmu05161]
Human Diseases; Infectious diseases; Herpes simplex infection [PATH:mmu05168]
Human Diseases; Infectious diseases; Toxoplasmosis [PATH:mmu05145]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
2 C3; 2 44.94 cM
AA seq 105 aa AA seqDB search
MGDAEAGKKIFVQKCAQCHTVEKGGKHKTGPNLWGLFGRKTGQAPGFSYTDANKNKGVIW
SEETLMEYLENPKKYIPGTKMIFAGIKKKSEREDLIKYLKQATSS
NT seq 318 nt NT seq  +upstreamnt  +downstreamnt
atgggagatgctgaagcaggcaagaagatctttgttcagaaatgtgctcagtgccacacg
gtggaaaaaggcgggaaacacaagacaggtccaaatctctggggcctctttggtcgaaag
acaggacaagcaccaggattttcttacacggatgcaaacaagaacaaaggtgttatctgg
tcagaagaaactttgatggaatatttggagaacccgaagaaatatatccctggcactaaa
atgatctttgctggtatcaaaaagaagagtgagagagaagatctcattaagtatttaaaa
caggccacatcctcatga

DBGET integrated database retrieval system