KEGG   Mus musculus (mouse): 13070Help
Entry
13070             CDS       T01002                                 

Gene name
Cyp11a1, Cyp11a, Cypxia1, D9Ertd411e, P450scc, Scc, cscc
Definition
(RefSeq) cytochrome P450, family 11, subfamily a, polypeptide 1
  KO
K00498  
cholesterol monooxygenase (side-chain-cleaving) [EC:1.14.15.6]
Organism
mmu  Mus musculus (mouse)
Pathway
Steroid hormone biosynthesis
Metabolic pathways
Ovarian steroidogenesis
Aldosterone synthesis and secretion
Module
Steroid hormone biosynthesis, cholesterol => prognenolone => progesterone
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Metabolism
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    13070 (Cyp11a1)
 Organismal Systems
  Endocrine system
   04913 Ovarian Steroidogenesis
    13070 (Cyp11a1)
   04925 Aldosterone synthesis and secretion
    13070 (Cyp11a1)
Enzymes [BR:mmu01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.15  With reduced iron-sulfur protein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.15.6  cholesterol monooxygenase (side-chain-cleaving)
     13070 (Cyp11a1)
Cytochrome P450 [BR:mmu00199]
 Cytochrome P450, animal type
  CYP11 family
   13070 (Cyp11a1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
9 B; 9 31.63 cM
AA seq 526 aa AA seqDB search
MLAKGLSLRSVLVKGCQPFLSPTWQGPVLSTGKGAGTSTSSPRSFNEIPSPGDNGWLNLY
HFWRESGTQKIHYHQMQSFQKYGPIYREKLGTLESVYIVDPKDASILFSCEGPNPERFLV
PPWVAYHQYYQRPIGVLFKSSDAWKKDRIVLNQEVMAPGAIKNFVPLLEGVAQDFIKVLH
RRIKQQNSGNFSGVISDDLFRFSFESISSVIFGERMGMLEEIVDPEAQRFINAVYQMFHT
SVPMLNLPPDFFRLLRTKTWKDHAAAWDVIFNKADEYTQNFYWDLRQKRDFSQYPGVLYS
LLGGNKLPFKNIQANITEMLAGGVDTTSMTLQWNLYEMAHNLKVQEMLRAEVLAARRQAQ
GDMAKMVQLVPLLKASIKETLRLHPISVTLQRYTVNDLVLRNYKIPAKTLVQVASFAMGR
DPGFFPNPNKFDPTRWLEKSQNTTHFRYLGFGWGVRQCLGRRIAELEMTILLINLLENFR
IEVQNLRDVGTKFSLILMPENPILFNFQPLKQDLGPAVTRKDNTVN
NT seq 1581 nt NT seq  +upstreamnt  +downstreamnt
atgctggctaaaggactttccctgcgctcagtgctggtcaaaggctgccaacctttcctg
agccctacgtggcagggtccagtgctgagtactggaaagggagctggtacctctactagc
agtcctaggtccttcaatgagatcccttcccctggcgacaatggttggctaaacctgtac
cacttctggagggagagtggcacacagaaaatccattaccatcagatgcagagtttccaa
aagtatggccccatttacagggagaagctgggcactttggagtcagtttacatcgtggac
cccaaggatgcgtcgatactcttctcatgcgagggtcccaacccggagcggttccttgtg
cccccctgggtggcctatcaccagtattatcagaggcccattggggtcctgtttaagagt
tcagatgcctggaagaaagaccgaatcgtcctaaaccaagaggtgatggcgcctggagcc
atcaagaacttcgtgcccctgctggaaggtgtagctcaggacttcatcaaagtcttacac
agacgcatcaagcagcaaaattctggaaatttctcaggggtcatcagtgatgacctattc
cgcttttcctttgagtccatcagcagtgttatatttggggagcgcatggggatgctggag
gagatcgtggatcccgaggcccagcggttcatcaatgctgtctaccagatgttccacacc
agtgtccccatgctcaacctgcctccagacttctttcgactcctcagaactaagacctgg
aaggaccatgcagctgcctgggatgtgattttcaataaagctgatgagtacacccagaac
ttctactgggacttaaggcagaagcgagacttcagccagtaccctggtgtcctttatagc
ctcctggggggcaacaagctgcccttcaagaacatccaggccaacattaccgagatgctg
gcaggaggggtggacacgacctccatgaccctgcagtggaacctttatgagatggcacac
aacttgaaggtacaggagatgctgcgggctgaagtcctggctgcccggcgccaggcccag
ggagacatggccaagatggtacagttggttccactcctcaaagccagcatcaaggagaca
ctgagactccaccccatctccgtgaccttgcagaggtacactgtgaatgacctggtgctt
cgtaattacaagattccagccaagactttggtacaggtggctagctttgccatgggtcga
gatccgggcttctttcccaatccaaacaagtttgacccaactcgttggctggaaaaaagc
caaaataccacccacttccggtacttgggctttggctggggtgttcggcagtgtctgggc
cggcggattgcggagctggagatgaccatcctccttatcaatctgctggagaacttcaga
attgaagttcaaaatctccgtgatgtggggaccaagttcagcctcatcctgatgcctgag
aaccccatcctcttcaacttccagcctctcaagcaggacctgggcccagccgtgaccaga
aaagacaacactgtgaactga

DBGET integrated database retrieval system