KEGG   Mus musculus (mouse): 13075Help
Entry
13075             CDS       T01002                                 

Gene name
Cyp19a1, Ar, ArKO, Cyp19, Int-5, Int5, p450arom
Definition
(RefSeq) cytochrome P450, family 19, subfamily a, polypeptide 1
  KO
K07434  aromatase [EC:1.14.14.14]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00140  Steroid hormone biosynthesis
mmu01100  Metabolic pathways
mmu04913  Ovarian steroidogenesis
Module
mmu_M00110  C19/C18-Steroid hormone biosynthesis, pregnenolone => androstenedione => estrone
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Metabolism
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    13075 (Cyp19a1)
 Organismal Systems
  Endocrine system
   04913 Ovarian Steroidogenesis
    13075 (Cyp19a1)
Enzymes [BR:mmu01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.14  aromatase
     13075 (Cyp19a1)
Cytochrome P450 [BR:mmu00199]
 Cytochrome P450, animal type
  CYP19 family
   13075 (Cyp19a1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: p450 DUF268
Motif
Other DBs
NCBI-GeneID: 13075
NCBI-ProteinID: NP_001335100
MGI: 88587
Ensembl: ENSMUSG00000032274
Vega: OTTMUSG00000063201
UniProt: P28649 Q3ZAT3
Position
9 A5.3; 9 29.49 cM
AA seq 503 aa AA seqDB search
MFLEMLNPMQYNVTIMVPETVTVSAMPLLLIMGLLLLIWNCESSSSIPGPGYCLGIGPLI
SHGRFLWMGIGSACNYYNKMYGEFMRVWISGEETLIISKSSSMFHVMKHSHYISRFGSKR
GLQCIGMHENGIIFNNNPSLWRTIRPFFMKALTGPGLVRMVEVCVESIKQHLDRLGEVTD
TSGYVDVLTLMRHIMLDTSNMLFLGIPLDESAIVKKIQGYFNAWQALLIKPNIFFKISWL
YRKYERSVKDLKDEIAVLVEKKRHKVSTAEKLEDCMDFATDLIFAERRGDLTKENVNQCI
LEMLIAAPDTMSVTLYFMLLLVAEYPEVEAAILKEIHTVVGDRDIKIEDIQNLKVVENFI
NESMRYQPVVDLVMRRALEDDVIDGYPVKKGTNIILNIGRMHRLEYFPKPNEFTLENFEK
NVPYRYFQPFGFGPRGCAGKYIAMVMMKVVLVTLLRRFQVKTLQKRCIENIPKKNDLSLH
PNEDRHLVEIIFSPRNSDKYLQQ
NT seq 1512 nt NT seq  +upstreamnt  +downstreamnt
atgttcttggaaatgctgaaccccatgcagtataatgtcaccatcatggtcccggaaact
gtgactgtcagtgccatgccactcctgctgatcatgggcctccttctcctgatttggaat
tgtgagagctcgtcttcaataccaggtcctggctactgtctgggaattgggcccctcatt
tcccatggcagattcttgtggatggggattggaagtgcctgcaactactacaataagatg
tatggagagttcatgagagtctggatcagtggagaggagacactcattatcagcaagtcc
tcaagcatgttccatgtcatgaagcacagtcactacatctcccgattcggcagcaagcgt
gggctgcagtgcatcggcatgcatgagaacggcatcatatttaacaacaacccgagcctt
tggagaacaattcgccctttctttatgaaagctctgacgggccctggtcttgttcgaatg
gtggaagtttgtgtggagtccatcaagcagcatttggaccggctgggcgaagtcaccgac
acctcgggctacgtggatgtgttgaccctcatgagacacatcatgctggacacctctaac
atgctcttcctggggatccccctggacgaaagtgctattgtgaagaaaatccagggttac
tttaacgcctggcaagctctcctcatcaaaccaaacatcttctttaagatttcttggctc
tacagaaagtatgaacgatccgtcaaggacttgaaagacgagatagctgttttggtggaa
aagaagagacacaaagtttccacagctgagaaactggaagactgtatggattttgcaact
gatttgattttcgctgagagacgtggagacctgacgaaagagaacgtgaatcagtgcata
ctggagatgctgattgcagcccctgacaccatgtcggtcactctgtacttcatgttactt
ctcgtcgcagagtatccagaggtcgaagcagcaatcctgaaggagatccacactgttgtg
ggtgacagagacataaagatcgaggatatccaaaatttaaaagtggtggaaaacttcatt
aatgaaagcatgcggtaccagcctgttgtggacttggtcatgcgcagagctctggaggat
gacgtaattgacggctacccggttaaaaagggaactaacatcattctgaacatcggaaga
atgcacaggctcgagtacttccctaagcccaatgaatttacccttgaaaactttgagaag
aatgttccctacaggtactttcagccttttggctttgggccccgcggctgtgctgggaag
tacatcgccatggtgatgatgaaagttgtcttggttacacttttgagacgattccaggtg
aagacactgcaaaaaaggtgtattgaaaacataccgaaaaagaatgacctgtccttgcac
ccaaatgaggacaggcaccttgtggaaataattttctctccaaggaattcagacaagtac
ctccaacagtga

DBGET integrated database retrieval system