KEGG   Mus musculus (mouse): 13076Help
Entry
13076             CDS       T01002                                 

Gene name
Cyp1a1, AHH, AHRR, CP11, Cyp1a2, P450-1
Definition
cytochrome P450, family 1, subfamily a, polypeptide 1 (EC:1.14.14.1)
Orthology
K07408  
cytochrome P450, family 1, subfamily A, polypeptide 1 [EC:1.14.14.1]
Organism
mmu  Mus musculus (mouse)
Pathway
Steroid hormone biosynthesis
Tryptophan metabolism
Retinol metabolism
Metabolism of xenobiotics by cytochrome P450
Metabolic pathways
Ovarian steroidogenesis
Chemical carcinogenesis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Metabolism
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    13076 (Cyp1a1)
  Amino acid metabolism
   00380 Tryptophan metabolism
    13076 (Cyp1a1)
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    13076 (Cyp1a1)
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    13076 (Cyp1a1)
 Organismal Systems
  Endocrine system
   04913 Ovarian Steroidogenesis
    13076 (Cyp1a1)
 Human Diseases
  Cancers
   05204 Chemical carcinogenesis
    13076 (Cyp1a1)
Enzymes [BR:mmu01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     13076 (Cyp1a1)
Cytochrome P450 [BR:mmu00199]
 Cytochrome P450, animal type
  CYP1 family
   13076 (Cyp1a1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
UniProt: 
Position
9 B; 9 31.34 cM
AA seq 524 aa AA seqDB search
MPSMYGLPAFVSATELLLAVTVFCLGFWVVRATRTWVPKGLKTPPGPWGLPFIGHMLTVG
KNPHLSLTRLSQQYGDVLQIRIGSTPVVVLSGLNTIKQALVRQGDDFKGRPDLYSFTLIT
NGKSMTFNPDSGPVWAARRRLAQNALKSFSIASDPTSASSCYLEEHVSKEANYLVSKLQK
VMAEVGHFDPYKYLVVSVANVICAICFGQRYDHDDQELLSIVNLSNEFGEVTGSGYPADF
IPVLRYLPNSSLDAFKDLNDKFYSFMKKLIKEHYRTFEKGHIRDITDSLIEHCQDRKLDE
NANVQLSDDKVITIVLDLFGAGFDTVTTAISWSLMYLVTNPRVQRKIQEELDTVIGRDRQ
PRLSDRPQLPYLEAFILETFRHSSFVPFTIPHSTTRDTSLNGFYIPKGCCVFVNQWQVNH
DRELWGDPNEFRPERFLTPSGTLDKRLSEKVTLFGLGKRKCIGETIGRSEVFLFLAILLQ
QIEFKVSPGEKVDMTPTYGLTLKHARCEHFQVQMRSSGPQHLQA
NT seq 1575 nt NT seq  +upstreamnt  +downstreamnt
atgccttccatgtatggacttccagccttcgtgtcagccacagagctgctcctggctgtc
accgtattctgccttggattctgggtggtcagagccacaagaacctgggttcccaaaggc
ctgaagactccaccagggccctggggcttgcccttcattggtcacatgctgactgtgggg
aagaacccacatctgtcactgacacggctgagtcagcagtatggggacgtgctgcagatc
cgcatcggctccactcctgtggtggtgctgagcggcctgaacaccatcaagcaggccctg
gtgaggcagggagatgacttcaagggccggccagacctctacagcttcacacttatcact
aatggcaagagcatgacttttaacccagactctggacccgtgtgggctgcccgccggcgc
ctggcccagaatgccctgaagagcttctccatagcctcggacccgacgtcagcatcctct
tgctacttggaggagcacgtgagcaaggaggctaactatctcgtcagcaaacttcagaag
gtgatggcagaggttggccactttgacccttacaagtatttggtcgtgtcagtagccaat
gtcatctgtgccatatgctttggccaacgttatgaccatgatgaccaagagctgctcagc
atagtcaatctgagcaatgagtttggggaggttactggctctggatacccagctgacttc
attcctgtcctccgttacctgcctaactcttccctggatgccttcaaggacttgaatgat
aagttctacagcttcatgaagaagttaatcaaagagcactacaggacatttgagaagggc
cacatccgggacatcacagacagcctcattgagcattgtcaggacaggaagctggacgag
aatgccaatgtccagctgtcagatgataaggtcatcacgattgttttggacctctttgga
gctgggtttgacacagtcacaactgctatctcgtggagcctcatgtacctggtaaccaac
cctagggtacagagaaagatccaggaggaactagacacagtgattggcagagatcggcag
ccccggctttctgacagacctcagctgccctatctggaggccttcattctggagaccttc
cggcattcatccttcgtccccttcaccatcccccacagcaccacaagagatacaagtctg
aatggcttctatatccccaaggggtgctgtgtctttgtgaaccagtggcaggttaaccat
gaccgggaactgtggggtgacccaaacgagttccggcctgaaaggtttctcacccccagc
ggcactctggacaagcgcttgagtgagaaggtcactctctttggtttgggcaagcgaaag
tgcatcggagagaccattggccgatcggaggtctttctcttcctggccatcttgctgcag
caaatagaatttaaggtgtctccaggggagaaggtggatatgactcctacctatgggctg
actttaaaacacgcccgctgtgaacacttccaagtgcagatgcggtcttctggtcctcag
catcttcaggcttag

DBGET integrated database retrieval system