KEGG   Mus musculus (mouse): 13078Help
Entry
13078             CDS       T01002                                 

Gene name
Cyp1b1, CP1B, P4501b1
Definition
cytochrome P450, family 1, subfamily b, polypeptide 1 (EC:1.14.14.1)
Orthology
K07410  
cytochrome P450, family 1, subfamily B, polypeptide 1 [EC:1.14.14.1]
Organism
mmu  Mus musculus (mouse)
Pathway
Steroid hormone biosynthesis
Tryptophan metabolism
Metabolism of xenobiotics by cytochrome P450
Ovarian steroidogenesis
Chemical carcinogenesis
MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Metabolism
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    13078 (Cyp1b1)
  Amino acid metabolism
   00380 Tryptophan metabolism
    13078 (Cyp1b1)
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    13078 (Cyp1b1)
 Organismal Systems
  Endocrine system
   04913 Ovarian Steroidogenesis
    13078 (Cyp1b1)
 Human Diseases
  Cancers
   05206 MicroRNAs in cancer
    13078 (Cyp1b1)
   05204 Chemical carcinogenesis
    13078 (Cyp1b1)
Enzymes [BR:mmu01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     13078 (Cyp1b1)
Cytochrome P450 [BR:mmu00199]
 Cytochrome P450, animal type
  CYP1 family
   13078 (Cyp1b1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
UniProt: 
Position
17 E3; 17
AA seq 543 aa AA seqDB search
MATSLSADSPQQLSSLSTQQTTLLLLFSVLAAVHLGQWLLRQWQRKPWSSPPGPFPWPLI
GNAAAVGQASHLYFARLARRYGDVFQIRLGSCPVVVLNGESAIHQALVQQGSIFADRPPF
ASFRVVSGGRSLAFGHYSEHWKTQRRSAYSTMRAFSTRHPRSRGLLEGHALAEARELVAV
LVRRCAGGAFLDPTQPVIVAVANVMSAVCFGCRYNHDDAEFLELLSHNEEFGRTVGAGSL
VDVLPWLQLFPNPVRTTFRKFEQLNRNFSNFVLDKFLRHRESLVPGAAPRDMTDAFILSA
EKKASGAPGDDSSGLDLEDVPATITDIFGASQDTLSTALLWLLILFTRYPDVQARVQAEL
DQVVGRDRLPCMSDQPNLPYVMAFLYESMRFSSFLPVTIPHATTANTFVLGYYIPKNTVV
FVNQWSVNHDPAKWPNPEDFDPARFLDKDGFINKALASSVMIFSVGKRRCIGEELSKMLL
FLFISILAHQCNFKANQNESSNMSFSYGLTIKPKSFRIHVSLRESMELLDNAVKKLQTEE
GCK
NT seq 1632 nt NT seq  +upstreamnt  +downstreamnt
atggccaccagccttagtgcagacagtccacagcagctgagctcgctgtctacccagcag
accactcttctgctactcttctccgtcctggccgccgtgcacttaggccagtggctgctg
cgacagtggcaacggaaaccgtggtcctcgcccccaggtccctttccttggccactgatc
ggaaacgcggcggctgttggccaggcgtcgcacttgtacttcgctcgccttgcaaggcgc
tatggcgacgttttccagatccgtctgggcagctgtcccgtggtggtgctgaatggagag
agtgccatccaccaggccctggtgcagcagggcagcatcttcgcggaccggccgcccttc
gcctctttccgtgtggtgtctggtggccgcagtctggcgttcggtcactactctgagcac
tggaagacgcagcgacgctcggcctatagcacgatgcgtgctttctccacgcgccacccg
cgcagtcgcggtcttctcgagggccacgcgctggcagaggctcgagaattggtggcagtg
ctggtgcggcgctgtgcgggcggcgccttcctcgatccaacgcagccggtcattgtggcg
gtggccaacgtcatgagcgctgtgtgcttcggctgtcggtacaaccacgacgatgcggag
ttcctagagctgctcagccacaatgaggagttcgggcgcacagtgggtgcgggcagcctg
gtggatgtgctgccctggctgcagctatttcccaacccggtgcgcaccaccttccgcaag
ttcgagcagctcaaccgcaacttcagcaacttcgttctggacaagttcctgaggcaccgc
gaaagcctggtgcccggggctgctcctcgagacatgacggacgccttcatcctctctgcc
gaaaagaaagcgtctggggcccctggcgacgattcctccgggctggacttggaggatgtg
cctgccactattacggacatcttcggagccagccaggacaccctttccaccgcgctgctg
tggctgctcatcctctttaccagatacccggatgttcaggcccgcgtgcaggctgagttg
gaccaggttgtggggagggaccgcctgccctgcatgagtgaccagcccaacctgccatat
gtcatggcttttctttatgaatcaatgcgattctccagctttttgcctgtcaccattcca
cacgccaccaccgccaacacctttgttttaggttactacatccccaagaatacggtcgtt
tttgttaaccagtggtctgtgaatcatgacccagccaagtggcctaacccagaggacttt
gatccagcccgcttcctggacaaggacggcttcattaacaaggcgctagccagcagtgtg
atgatattctcagtgggcaaacggaggtgcatcggtgaggaactgtctaagatgcttctg
tttctcttcatctccatcctcgctcatcagtgcaatttcaaggctaaccaaaatgagtcc
tcaaacatgagtttcagttatggcctgaccattaagcccaagtcgtttagaatccatgtg
tctctcagagagtcgatggaactcctggataatgctgttaaaaagctgcaaactgaggaa
ggctgcaagtga

DBGET integrated database retrieval system