KEGG   Mus musculus (mouse): 13078Help
Entry
13078             CDS       T01002                                 

Gene name
Cyp1b1, CP1B, P4501b1
Definition
cytochrome P450, family 1, subfamily b, polypeptide 1 (EC:1.14.14.1)
Orthology
K07410  
cytochrome P450, family 1, subfamily B, polypeptide 1 [EC:1.14.14.1]
Organism
mmu  Mus musculus (mouse)
Pathway
Steroid hormone biosynthesis
Tryptophan metabolism
Metabolism of xenobiotics by cytochrome P450
Ovarian steroidogenesis
Chemical carcinogenesis
MicroRNAs in cancer
Class
Metabolism; Lipid metabolism; Steroid hormone biosynthesis [PATH:mmu00140]
Metabolism; Amino acid metabolism; Tryptophan metabolism [PATH:mmu00380]
Metabolism; Xenobiotics biodegradation and metabolism; Metabolism of xenobiotics by cytochrome P450 [PATH:mmu00980]
Organismal Systems; Endocrine system; Ovarian Steroidogenesis [PATH:mmu04913]
Human Diseases; Cancers; MicroRNAs in cancer [PATH:mmu05206]
Human Diseases; Cancers; Chemical carcinogenesis [PATH:mmu05204]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
UniProt: 
Position
17 E3; 17
AA seq 543 aa AA seqDB search
MATSLSADSPQQLSSLSTQQTTLLLLFSVLAAVHLGQWLLRQWQRKPWSSPPGPFPWPLI
GNAAAVGQASHLYFARLARRYGDVFQIRLGSCPVVVLNGESAIHQALVQQGSIFADRPPF
ASFRVVSGGRSLAFGHYSEHWKTQRRSAYSTMRAFSTRHPRSRGLLEGHALAEARELVAV
LVRRCAGGAFLDPTQPVIVAVANVMSAVCFGCRYNHDDAEFLELLSHNEEFGRTVGAGSL
VDVLPWLQLFPNPVRTTFRKFEQLNRNFSNFVLDKFLRHRESLVPGAAPRDMTDAFILSA
EKKASGAPGDDSSGLDLEDVPATITDIFGASQDTLSTALLWLLILFTRYPDVQARVQAEL
DQVVGRDRLPCMSDQPNLPYVMAFLYESMRFSSFLPVTIPHATTANTFVLGYYIPKNTVV
FVNQWSVNHDPAKWPNPEDFDPARFLDKDGFINKALASSVMIFSVGKRRCIGEELSKMLL
FLFISILAHQCNFKANQNESSNMSFSYGLTIKPKSFRIHVSLRESMELLDNAVKKLQTEE
GCK
NT seq 1632 nt NT seq  +upstreamnt  +downstreamnt
atggccaccagccttagtgcagacagtccacagcagctgagctcgctgtctacccagcag
accactcttctgctactcttctccgtcctggccgccgtgcacttaggccagtggctgctg
cgacagtggcaacggaaaccgtggtcctcgcccccaggtccctttccttggccactgatc
ggaaacgcggcggctgttggccaggcgtcgcacttgtacttcgctcgccttgcaaggcgc
tatggcgacgttttccagatccgtctgggcagctgtcccgtggtggtgctgaatggagag
agtgccatccaccaggccctggtgcagcagggcagcatcttcgcggaccggccgcccttc
gcctctttccgtgtggtgtctggtggccgcagtctggcgttcggtcactactctgagcac
tggaagacgcagcgacgctcggcctatagcacgatgcgtgctttctccacgcgccacccg
cgcagtcgcggtcttctcgagggccacgcgctggcagaggctcgagaattggtggcagtg
ctggtgcggcgctgtgcgggcggcgccttcctcgatccaacgcagccggtcattgtggcg
gtggccaacgtcatgagcgctgtgtgcttcggctgtcggtacaaccacgacgatgcggag
ttcctagagctgctcagccacaatgaggagttcgggcgcacagtgggtgcgggcagcctg
gtggatgtgctgccctggctgcagctatttcccaacccggtgcgcaccaccttccgcaag
ttcgagcagctcaaccgcaacttcagcaacttcgttctggacaagttcctgaggcaccgc
gaaagcctggtgcccggggctgctcctcgagacatgacggacgccttcatcctctctgcc
gaaaagaaagcgtctggggcccctggcgacgattcctccgggctggacttggaggatgtg
cctgccactattacggacatcttcggagccagccaggacaccctttccaccgcgctgctg
tggctgctcatcctctttaccagatacccggatgttcaggcccgcgtgcaggctgagttg
gaccaggttgtggggagggaccgcctgccctgcatgagtgaccagcccaacctgccatat
gtcatggcttttctttatgaatcaatgcgattctccagctttttgcctgtcaccattcca
cacgccaccaccgccaacacctttgttttaggttactacatccccaagaatacggtcgtt
tttgttaaccagtggtctgtgaatcatgacccagccaagtggcctaacccagaggacttt
gatccagcccgcttcctggacaaggacggcttcattaacaaggcgctagccagcagtgtg
atgatattctcagtgggcaaacggaggtgcatcggtgaggaactgtctaagatgcttctg
tttctcttcatctccatcctcgctcatcagtgcaatttcaaggctaaccaaaatgagtcc
tcaaacatgagtttcagttatggcctgaccattaagcccaagtcgtttagaatccatgtg
tctctcagagagtcgatggaactcctggataatgctgttaaaaagctgcaaactgaggaa
ggctgcaagtga

DBGET integrated database retrieval system