KEGG   Mus musculus (mouse): 13079Help
Entry
13079             CDS       T01002                                 

Gene name
Cyp21a1, 21-OH, 21OH, 21OHA, 21OHB, CYP21OH-A, Cyp21, Cyp21-ps1, Cyp21B, Cyp21a2-ps, Cyp21a2ps, Oh21-1, Oh21-2
Definition
(RefSeq) cytochrome P450, family 21, subfamily a, polypeptide 1 (EC:1.14.99.10)
  KO
K00513  
steroid 21-monooxygenase [EC:1.14.14.16]
Organism
mmu  Mus musculus (mouse)
Pathway
Steroid hormone biosynthesis
Metabolic pathways
Aldosterone synthesis and secretion
Module
C21-Steroid hormone biosynthesis, progesterone => corticosterone/aldosterone
C21-Steroid hormone biosynthesis, progesterone => cortisol/cortisone
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Metabolism
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    13079 (Cyp21a1)
 Organismal Systems
  Endocrine system
   04925 Aldosterone synthesis and secretion
    13079 (Cyp21a1)
Enzymes [BR:mmu01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.16  steroid 21-monooxygenase
     13079 (Cyp21a1)
Cytochrome P450 [BR:mmu00199]
 Cytochrome P450, animal type
  CYP21 family
   13079 (Cyp21a1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
17 B1; 17 18.36 cM
AA seq 487 aa AA seqDB search
MLLPGLLLLLLLLAGTRWLWGQWKLRKLHLPPLAPGFLHFLQPNLPIYLLGLTQKLGPIY
RIRLGMQDVVVLNSNRTIEEALIQKWVDFAGRPHMLNGKMDLDLSLGDYSLMWKAHKKLS
RSALMLGMRDSMEPLIEQLTQEFCERMRAQAGTPVAIHKEFSFLTCSIISCLTFGDKDST
LVQTLHDCVQDLLQAWNHWSIQILTIIPLLRFLPNPGLQKLKQIQESRDHIVKQQLKRHK
DSLVAGQWKDMIDYMLQGVEKQRDGKDEERLHEGHVHMSVVDLFIGGTETTATTLSWAVA
FLLHHPEIQKRLQEELDLKLGPGSQLLYRNRMQLPLLMATIAEVLRLRPVVPLALPHRAT
RASSISGYDIPKDMVIIPNIQGANLDEMVWELPSKFWPDRFLEPGKNPRTPSFGCGARVC
LGEPLARLELFVVLARLLQAFTLLPPPDGTLPSLQPQPYAGINLPIPPFQVRLQPRNLAP
QDQGERP
NT seq 1464 nt NT seq  +upstreamnt  +downstreamnt
atgctgctacctgggctgctgctgctgttgctgctgctagctggcacccgctggctgtgg
ggccaatggaagctccggaagctgcacctcccgcctctggccccgggttttctgcacttc
ctacagcctaaccttcccatctacctgcttggcctcactcagaaactcgggcccatctac
aggatccgcttggggatgcaagatgtggtggtgctaaattctaacagaaccattgaggag
gccttgatccaaaagtgggtggactttgctggccgaccccatatgctaaatggaaagatg
gacttggacctgtccctgggggattactctctcatgtggaaggcccacaagaaactctct
cgctcagccctgatgctgggcatgcgagactccatggagcctctgatagagcagctgacc
caggagttctgtgagcgcatgcgagcccaggctggcacccccgtggccatccataaggaa
ttctccttcctcacttgtagtatcatctcctgcctcacttttggagacaaggacagcacg
ttggtacagacccttcacgactgtgtccaggacttgttgcaagcctggaaccactggtcc
atccaaatcttgacgataattccccttctcaggttcctccccaacccaggcctccagaag
ctgaagcagatccaagagagtcgggaccatattgtcaagcagcagctgaagcggcacaag
gacagcctggttgcaggccaatggaaagacatgattgactacatgctccagggagtggag
aagcaaagggatggcaaagacgaagagcggctccacgaggggcacgtgcacatgtcggtg
gtggacctgttcatcggcggcaccgagaccacggctaccacgctctcctgggctgtggct
ttcctgcttcaccaccctgagatccagaagcgactgcaggaagagttagacctcaagctg
ggcccaggctcccagctcctgtacaggaaccgaatgcagctgcctctgctcatggccacc
attgccgaggtgctgcgtttgcggcctgtggtgcccttggccttgccccatcgtgcaact
agggctagcagcatctccggctatgacatccctaaggatatggtcatcatccccaacatc
caaggcgccaacctggatgagatggtttgggaactgcccagcaagttctggccagatcgc
ttcctggaacctgggaagaatcccagaacaccatcctttggctgtggggcacgcgtgtgc
ctgggagagcctctggcacggctggagctctttgtggtgctggctcgtctgctgcaggcc
ttcactctgctgcctccaccagatggaaccctgccttccctgcagccccagccttatgct
ggcatcaatctcccgattcctcctttccaggtgcggctgcagcccagaaacctggcgccc
caagaccagggtgagcgtccttga

DBGET integrated database retrieval system