KEGG   Mus musculus (mouse): 13079Help
Entry
13079             CDS       T01002                                 

Gene name
Cyp21a1, 21-OH, 21OH, 21OHA, 21OHB, CYP21OH-A, Cyp21, Cyp21-ps1, Cyp21B, Cyp21a2-ps, Cyp21a2ps, Oh21-1, Oh21-2
Definition
cytochrome P450, family 21, subfamily a, polypeptide 1 (EC:1.14.99.10)
Orthology
K00513  
steroid 21-monooxygenase [EC:1.14.99.10]
Organism
mmu  Mus musculus (mouse)
Pathway
Steroid hormone biosynthesis
Metabolic pathways
Module
C21-Steroid hormone biosynthesis, progesterone => corticosterone/aldosterone
C21-Steroid hormone biosynthesis, progesterone => cortisol/cortisone
Class
Metabolism; Lipid metabolism; Steroid hormone biosynthesis [PATH:mmu00140]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
17 B1; 17 18.36 cM
AA seq 487 aa AA seqDB search
MLLPGLLLLLLLLAGTRWLWGQWKLRKLHLPPLAPGFLHFLQPNLPIYLLGLTQKLGPIY
RIRLGMQDVVVLNSNRTIEEALIQKWVDFAGRPHMLNGKMDLDLSLGDYSLMWKAHKKLS
RSALMLGMRDSMEPLIEQLTQEFCERMRAQAGTPVAIHKEFSFLTCSIISCLTFGDKDST
LVQTLHDCVQDLLQAWNHWSIQILTIIPLLRFLPNPGLQKLKQIQESRDHIVKQQLKRHK
DSLVAGQWKDMIDYMLQGVEKQRDGKDEERLHEGHVHMSVVDLFIGGTETTATTLSWAVA
FLLHHPEIQKRLQEELDLKLGPGSQLLYRNRMQLPLLMATIAEVLRLRPVVPLALPHRAT
RASSISGYDIPKDMVIIPNIQGANLDEMVWELPSKFWPDRFLEPGKNPRTPSFGCGARVC
LGEPLARLELFVVLARLLQAFTLLPPPDGTLPSLQPQPYAGINLPIPPFQVRLQPRNLAP
QDQGERP
NT seq 1464 nt NT seq  +upstreamnt  +downstreamnt
atgctgctacctgggctgctgctgctgttgctgctgctagctggcacccgctggctgtgg
ggccaatggaagctccggaagctgcacctcccgcctctggccccgggttttctgcacttc
ctacagcctaaccttcccatctacctgcttggcctcactcagaaactcgggcccatctac
aggatccgcttggggatgcaagatgtggtggtgctaaattctaacagaaccattgaggag
gccttgatccaaaagtgggtggactttgctggccgaccccatatgctaaatggaaagatg
gacttggacctgtccctgggggattactctctcatgtggaaggcccacaagaaactctct
cgctcagccctgatgctgggcatgcgagactccatggagcctctgatagagcagctgacc
caggagttctgtgagcgcatgcgagcccaggctggcacccccgtggccatccataaggaa
ttctccttcctcacttgtagtatcatctcctgcctcacttttggagacaaggacagcacg
ttggtacagacccttcacgactgtgtccaggacttgttgcaagcctggaaccactggtcc
atccaaatcttgacgataattccccttctcaggttcctccccaacccaggcctccagaag
ctgaagcagatccaagagagtcgggaccatattgtcaagcagcagctgaagcggcacaag
gacagcctggttgcaggccaatggaaagacatgattgactacatgctccagggagtggag
aagcaaagggatggcaaagacgaagagcggctccacgaggggcacgtgcacatgtcggtg
gtggacctgttcatcggcggcaccgagaccacggctaccacgctctcctgggctgtggct
ttcctgcttcaccaccctgagatccagaagcgactgcaggaagagttagacctcaagctg
ggcccaggctcccagctcctgtacaggaaccgaatgcagctgcctctgctcatggccacc
attgccgaggtgctgcgtttgcggcctgtggtgcccttggccttgccccatcgtgcaact
agggctagcagcatctccggctatgacatccctaaggatatggtcatcatccccaacatc
caaggcgccaacctggatgagatggtttgggaactgcccagcaagttctggccagatcgc
ttcctggaacctgggaagaatcccagaacaccatcctttggctgtggggcacgcgtgtgc
ctgggagagcctctggcacggctggagctctttgtggtgctggctcgtctgctgcaggcc
ttcactctgctgcctccaccagatggaaccctgccttccctgcagccccagccttatgct
ggcatcaatctcccgattcctcctttccaggtgcggctgcagcccagaaacctggcgccc
caagaccagggtgagcgtccttga

DBGET integrated database retrieval system