KEGG   Mus musculus (mouse): 13086Help
Entry
13086             CDS       T01002                                 

Gene name
Cyp2a4, AI893559, Cyp15a1, D7Ucla4
Definition
cytochrome P450, family 2, subfamily a, polypeptide 4 (EC:1.14.14.1)
Orthology
K07411  
cytochrome P450, family 2, subfamily A [EC:1.14.14.1]
Organism
mmu  Mus musculus (mouse)
Pathway
Retinol metabolism
Class
Metabolism; Metabolism of cofactors and vitamins; Retinol metabolism [PATH:mmu00830]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
UniProt: 
Position
7 A3; 7 14.39 cM
AA seq 494 aa AA seqDB search
MLTSGLLLVAAVAFLSVLVLMSVWKQRKLSGKLPPGPTPLPFVGNFLQLNTEQMYNSLMK
ISQRYGPVFTIYLGSRRIVVLCGQETVKEALVDQAEEFSGRGEQATFDWLFKGYGIAFSS
GERAKQLRRFSITTLRDFGVGKRGIEERIQEEAGFLIDSFRKTNGAFIDPTFYLSRTVSN
VISSIVFGDRFDYEDKEFLSLLRMMLGSLQFTATSMGQVYEMFSSVMKHLPGPQQQAFKE
LQGLEDFITKKVEHNQRTLDPNSPRDFIDSFLIRMLEEKKNPNTEFYMKNLVLTTLNLFF
AGTETVSTTLRYGFLLLMKYPDIEAKVHEEIDRVIGRNRQPKYEDRMKMPYTEAVIHEIQ
RFADLIPMGLARRVTKDTKFRDFLLPKGTEVFPMLGSVLKDPKFFSNPKDFNPKHFLDDK
GQFKKSDAFVPFSIGKRYCFGEGLARMELFLFLTNIMQNFHFKSTQEPQDIDVSPRLVGF
VTIPPTYTMSFLSR
NT seq 1485 nt NT seq  +upstreamnt  +downstreamnt
atgctgacctcaggactcctcctggtggctgcagtggccttcctcagcgtcctggttttg
atgtctgtctggaagcagagaaagctctcaggaaagctgcctccaggacccaccccactg
cccttcgttgggaacttccttcagctgaacacagagcaaatgtacaactctctcatgaag
atcagccaacgttatggtcctgtattcaccatctatctgggatctcgccgaattgtggtg
ctgtgcggacaggagacagtcaaggaagctctggtggaccaagctgaggaattcagcggg
cggggcgagcaggctaccttcgactggcttttcaaaggctatggcatagccttcagcagc
ggggagcgagccaaacagctaaggcgcttctccatcaccacgctgcgggacttcggcgtg
gggaagcgtggcatcgaggagcgcatccaagaggaggcgggctttctcatcgattcattt
cggaagacgaacggtgctttcattgaccccaccttctaccttagccgaacagtctccaat
gtcattagctcaatcgtcttcggggaccgctttgactatgaggacaaagagttcctgtca
cttcttagaatgatgctgggaagcctccagttcactgctacctccatggggcaggtctat
gagatgttttcttctgtgatgaaacacctgccagggccccagcaacaggcctttaaggag
ctgcaaggcctggaggactttataaccaagaaagtggaacacaatcagcgcacgctggat
cccaattccccaagggacttcatcgactccttcctcatccgaatgctggaggagaagaag
aaccccaatactgagttctacatgaagaacttggtgctgactacactaaatctcttcttt
gctggcacagagaccgtcagcaccaccctgcgctatggctttctgttgctcatgaagtac
ccagatattgaggccaaggtccatgaggagattgatcgggtgattggcaggaaccggcag
cccaagtatgaggaccgaatgaagatgccctatacggaggctgtaatccatgagatccag
agatttgcagacctgatccccatgggcctggctcgaagggtcaccaaggacaccaagttt
cgagatttcctcctccccaagggtactgaagtatttcctatgctgggctctgtgctgaaa
gaccccaagttcttctccaaccccaaagacttcaacccaaagcacttcctagatgacaag
ggacagtttaagaagagtgatgcctttgtgcccttttccattggaaaacggtattgtttc
ggagaaggactggctaggatggaactcttcctcttcctcacaaacatcatgcagaacttc
cacttcaaatccacacaggaaccccaggacatcgatgtgtctcctagactcgtgggcttt
gtcacgatcccaccaacctacactatgagtttcttgtcccgttga

DBGET integrated database retrieval system