KEGG   Mus musculus (mouse): 13086Help
Entry
13086             CDS       T01002                                 

Gene name
Cyp2a4, AI893559, Cyp15a1, D7Ucla4
Definition
cytochrome P450, family 2, subfamily a, polypeptide 4 (EC:1.14.14.1)
Orthology
K07411  
cytochrome P450, family 2, subfamily A [EC:1.14.14.1]
Organism
mmu  Mus musculus (mouse)
Pathway
Retinol metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    13086 (Cyp2a4)
Enzymes [BR:mmu01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     13086 (Cyp2a4)
Cytochrome P450 [BR:mmu00199]
 Cytochrome P450, animal type
  CYP2 family
   13086 (Cyp2a4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
UniProt: 
Position
7 A3; 7 14.39 cM
AA seq 494 aa AA seqDB search
MLTSGLLLVAAVAFLSVLVLMSVWKQRKLSGKLPPGPTPLPFVGNFLQLNTEQMYNSLMK
ISQRYGPVFTIYLGSRRIVVLCGQETVKEALVDQAEEFSGRGEQATFDWLFKGYGIAFSS
GERAKQLRRFSITTLRDFGVGKRGIEERIQEEAGFLIDSFRKTNGAFIDPTFYLSRTVSN
VISSIVFGDRFDYEDKEFLSLLRMMLGSLQFTATSMGQVYEMFSSVMKHLPGPQQQAFKE
LQGLEDFITKKVEHNQRTLDPNSPRDFIDSFLIRMLEEKKNPNTEFYMKNLVLTTLNLFF
AGTETVSTTLRYGFLLLMKYPDIEAKVHEEIDRVIGRNRQPKYEDRMKMPYTEAVIHEIQ
RFADLIPMGLARRVTKDTKFRDFLLPKGTEVFPMLGSVLKDPKFFSNPKDFNPKHFLDDK
GQFKKSDAFVPFSIGKRYCFGEGLARMELFLFLTNIMQNFHFKSTQEPQDIDVSPRLVGF
VTIPPTYTMSFLSR
NT seq 1485 nt NT seq  +upstreamnt  +downstreamnt
atgctgacctcaggactcctcctggtggctgcagtggccttcctcagcgtcctggttttg
atgtctgtctggaagcagagaaagctctcaggaaagctgcctccaggacccaccccactg
cccttcgttgggaacttccttcagctgaacacagagcaaatgtacaactctctcatgaag
atcagccaacgttatggtcctgtattcaccatctatctgggatctcgccgaattgtggtg
ctgtgcggacaggagacagtcaaggaagctctggtggaccaagctgaggaattcagcggg
cggggcgagcaggctaccttcgactggcttttcaaaggctatggcatagccttcagcagc
ggggagcgagccaaacagctaaggcgcttctccatcaccacgctgcgggacttcggcgtg
gggaagcgtggcatcgaggagcgcatccaagaggaggcgggctttctcatcgattcattt
cggaagacgaacggtgctttcattgaccccaccttctaccttagccgaacagtctccaat
gtcattagctcaatcgtcttcggggaccgctttgactatgaggacaaagagttcctgtca
cttcttagaatgatgctgggaagcctccagttcactgctacctccatggggcaggtctat
gagatgttttcttctgtgatgaaacacctgccagggccccagcaacaggcctttaaggag
ctgcaaggcctggaggactttataaccaagaaagtggaacacaatcagcgcacgctggat
cccaattccccaagggacttcatcgactccttcctcatccgaatgctggaggagaagaag
aaccccaatactgagttctacatgaagaacttggtgctgactacactaaatctcttcttt
gctggcacagagaccgtcagcaccaccctgcgctatggctttctgttgctcatgaagtac
ccagatattgaggccaaggtccatgaggagattgatcgggtgattggcaggaaccggcag
cccaagtatgaggaccgaatgaagatgccctatacggaggctgtaatccatgagatccag
agatttgcagacctgatccccatgggcctggctcgaagggtcaccaaggacaccaagttt
cgagatttcctcctccccaagggtactgaagtatttcctatgctgggctctgtgctgaaa
gaccccaagttcttctccaaccccaaagacttcaacccaaagcacttcctagatgacaag
ggacagtttaagaagagtgatgcctttgtgcccttttccattggaaaacggtattgtttc
ggagaaggactggctaggatggaactcttcctcttcctcacaaacatcatgcagaacttc
cacttcaaatccacacaggaaccccaggacatcgatgtgtctcctagactcgtgggcttt
gtcacgatcccaccaacctacactatgagtttcttgtcccgttga

DBGET integrated database retrieval system