KEGG   Mus musculus (mouse): 13090Help
Entry
13090             CDS       T01002                                 

Gene name
Cyp2b19
Definition
cytochrome P450, family 2, subfamily b, polypeptide 19 (EC:1.14.14.1)
Orthology
K07412  
cytochrome P450, family 2, subfamily B [EC:1.14.14.1]
Organism
mmu  Mus musculus (mouse)
Pathway
Steroid hormone biosynthesis
Arachidonic acid metabolism
Retinol metabolism
Metabolic pathways
Chemical carcinogenesis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Metabolism
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    13090 (Cyp2b19)
   00590 Arachidonic acid metabolism
    13090 (Cyp2b19)
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    13090 (Cyp2b19)
 Human Diseases
  Cancers
   05204 Chemical carcinogenesis
    13090 (Cyp2b19)
Enzymes [BR:mmu01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     13090 (Cyp2b19)
Cytochrome P450 [BR:mmu00199]
 Cytochrome P450, animal type
  CYP2 family
   13090 (Cyp2b19)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
7 A3; 7 15.44 cM
AA seq 492 aa AA seqDB search
MEFSVLLLLALTTGFLIFLVSQSQPKTHGHFPPGPRPLPFLGNLLQMDRRGLLSSFIQLQ
EKYGDVFTVHLGPRPVVMLCGTDTIREALVNQAEAFSGRGTVAVLDPIVQGYGVIFSSGE
RWKTLRRFSLATMRDFGMGKRSVEERIKEEAQCLVEELKKYKGAPLNPTFYFQCIVANII
CSIVFGERFDYKDHQFLHLLNLIYQTFSLMSSLSSQVFELFSAILKYFPGAHRQISKNLQ
EILDYIGHSVEKHRATLDPSAPRDFIDTYLLRMEKEKSNHHTEFHHQNLVISVLSLFFAG
TETTSTTLRYSFLIMLKYPHVAEKVQKEIDQVIGSHRLPTLDDRTKMPYTDAVIHEIQRF
TDLAPIGLPHKVTKDTLFRGYLIPKNTEVYPILSSALHDPRYFEQPDSFNPEHFLDANGA
LKTNEAFMPFSTGKRICLGEGIARNELFLFFTTILQNFSLASPVAPENIDLIPNNSGATK
TPPQYQIHFLSR
NT seq 1479 nt NT seq  +upstreamnt  +downstreamnt
atggaattcagtgtgctgctccttctcgctctcaccacaggcttcttgatattcttagtc
agccaaagtcagccaaagacccatggccacttcccaccaggacctcgtcccctgcccttc
ttgggtaacctcttgcagatggacagacggggccttctgagctctttcatacagcttcaa
gaaaaatatggagatgtgttcacagtacacctgggaccgaggcccgtggtcatgttgtgc
gggacagacaccataagggaagctctggtgaaccaagctgaggctttctctggccgaggg
acagttgctgtgcttgatccaattgttcagggatatggtgtgatcttttccagtggggaa
cgttggaaaacccttcggcgattctctctggccaccatgagagactttgggatgggaaag
cggagtgtggaggagcggataaaggaagaggcccaatgtttggtggaggaactgaagaaa
tacaagggagcccctctgaaccccaccttctacttccagtgcatcgtagcaaatatcatc
tgctccattgtctttggagagcgctttgactacaaagaccaccaattcctgcatctgcta
aatctgatctaccagacattttccctcatgagctcattgtccagccaggtgtttgagctc
ttctctgccatcctgaagtactttcctggtgcccacagacaaatctccaaaaacctgcag
gaaatccttgactacattggccatagtgtggagaagcacagggccaccttggaccccagt
gctccacgagacttcattgatacctaccttctgcgcatggagaaggagaagtccaaccac
catacagagttccatcaccagaacctcgtgatctctgtgctctctctgttctttgctggc
accgagaccaccagcaccacgctccgttacagcttcctgatcatgctcaagtacccccat
gtcgcagagaaagtccaaaaggagattgatcaggtgatcggctcacaccggctaccgact
cttgatgatagaaccaaaatgccatacactgatgcagtcatccatgagattcagagattt
acagatcttgctccgattggtctaccacacaaagtcaccaaagacacactgttccgagga
tacctgatccccaagaacactgaggtgtaccccatcctgagttcagctcttcatgaccca
cggtactttgaacaaccagacagcttcaatcctgagcacttcctggatgccaatggggca
ctgaagacaaatgaagctttcatgcccttctccacaggaaagcgcatttgtcttggagaa
ggcattgcccgcaatgaattgttccttttcttcaccaccatcctccagaacttctctttg
gccagccctgtagctcctgagaacattgacctcattcccaataacagtggtgcaaccaaa
acacccccacagtaccagattcacttcttgtcccgttga

DBGET integrated database retrieval system