KEGG   Mus musculus (mouse): 13090Help
Entry
13090             CDS       T01002                                 

Gene name
Cyp2b19
Definition
cytochrome P450, family 2, subfamily b, polypeptide 19 (EC:1.14.14.1)
Orthology
K07412  
cytochrome P450, family 2, subfamily B [EC:1.14.14.1]
Organism
mmu  Mus musculus (mouse)
Pathway
Steroid hormone biosynthesis
Arachidonic acid metabolism
Retinol metabolism
Metabolic pathways
Chemical carcinogenesis
Class
Metabolism; Lipid metabolism; Steroid hormone biosynthesis [PATH:mmu00140]
Metabolism; Lipid metabolism; Arachidonic acid metabolism [PATH:mmu00590]
Metabolism; Metabolism of cofactors and vitamins; Retinol metabolism [PATH:mmu00830]
Human Diseases; Cancers; Chemical carcinogenesis [PATH:mmu05204]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
7 A3; 7 15.44 cM
AA seq 492 aa AA seqDB search
MEFSVLLLLALTTGFLIFLVSQSQPKTHGHFPPGPRPLPFLGNLLQMDRRGLLSSFIQLQ
EKYGDVFTVHLGPRPVVMLCGTDTIREALVNQAEAFSGRGTVAVLDPIVQGYGVIFSSGE
RWKTLRRFSLATMRDFGMGKRSVEERIKEEAQCLVEELKKYKGAPLNPTFYFQCIVANII
CSIVFGERFDYKDHQFLHLLNLIYQTFSLMSSLSSQVFELFSAILKYFPGAHRQISKNLQ
EILDYIGHSVEKHRATLDPSAPRDFIDTYLLRMEKEKSNHHTEFHHQNLVISVLSLFFAG
TETTSTTLRYSFLIMLKYPHVAEKVQKEIDQVIGSHRLPTLDDRTKMPYTDAVIHEIQRF
TDLAPIGLPHKVTKDTLFRGYLIPKNTEVYPILSSALHDPRYFEQPDSFNPEHFLDANGA
LKTNEAFMPFSTGKRICLGEGIARNELFLFFTTILQNFSLASPVAPENIDLIPNNSGATK
TPPQYQIHFLSR
NT seq 1479 nt NT seq  +upstreamnt  +downstreamnt
atggaattcagtgtgctgctccttctcgctctcaccacaggcttcttgatattcttagtc
agccaaagtcagccaaagacccatggccacttcccaccaggacctcgtcccctgcccttc
ttgggtaacctcttgcagatggacagacggggccttctgagctctttcatacagcttcaa
gaaaaatatggagatgtgttcacagtacacctgggaccgaggcccgtggtcatgttgtgc
gggacagacaccataagggaagctctggtgaaccaagctgaggctttctctggccgaggg
acagttgctgtgcttgatccaattgttcagggatatggtgtgatcttttccagtggggaa
cgttggaaaacccttcggcgattctctctggccaccatgagagactttgggatgggaaag
cggagtgtggaggagcggataaaggaagaggcccaatgtttggtggaggaactgaagaaa
tacaagggagcccctctgaaccccaccttctacttccagtgcatcgtagcaaatatcatc
tgctccattgtctttggagagcgctttgactacaaagaccaccaattcctgcatctgcta
aatctgatctaccagacattttccctcatgagctcattgtccagccaggtgtttgagctc
ttctctgccatcctgaagtactttcctggtgcccacagacaaatctccaaaaacctgcag
gaaatccttgactacattggccatagtgtggagaagcacagggccaccttggaccccagt
gctccacgagacttcattgatacctaccttctgcgcatggagaaggagaagtccaaccac
catacagagttccatcaccagaacctcgtgatctctgtgctctctctgttctttgctggc
accgagaccaccagcaccacgctccgttacagcttcctgatcatgctcaagtacccccat
gtcgcagagaaagtccaaaaggagattgatcaggtgatcggctcacaccggctaccgact
cttgatgatagaaccaaaatgccatacactgatgcagtcatccatgagattcagagattt
acagatcttgctccgattggtctaccacacaaagtcaccaaagacacactgttccgagga
tacctgatccccaagaacactgaggtgtaccccatcctgagttcagctcttcatgaccca
cggtactttgaacaaccagacagcttcaatcctgagcacttcctggatgccaatggggca
ctgaagacaaatgaagctttcatgcccttctccacaggaaagcgcatttgtcttggagaa
ggcattgcccgcaatgaattgttccttttcttcaccaccatcctccagaacttctctttg
gccagccctgtagctcctgagaacattgacctcattcccaataacagtggtgcaaccaaa
acacccccacagtaccagattcacttcttgtcccgttga

DBGET integrated database retrieval system