KEGG   Mus musculus (mouse): 13095Help
Entry
13095             CDS       T01002                                 

Gene name
Cyp2c29, AHOH, AHOHase, AI159681, AI196010, Ah-2, Ahh-1, Cyp2c, P450-2C
Definition
cytochrome P450, family 2, subfamily c, polypeptide 29 (EC:1.14.14.1)
Orthology
K07413  
cytochrome P450, family 2, subfamily C [EC:1.14.14.1]
Organism
mmu  Mus musculus (mouse)
Pathway
Steroid hormone biosynthesis
Arachidonic acid metabolism
Linoleic acid metabolism
Retinol metabolism
Metabolic pathways
Serotonergic synapse
Inflammatory mediator regulation of TRP channels
Chemical carcinogenesis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Metabolism
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    13095 (Cyp2c29)
   00590 Arachidonic acid metabolism
    13095 (Cyp2c29)
   00591 Linoleic acid metabolism
    13095 (Cyp2c29)
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    13095 (Cyp2c29)
 Organismal Systems
  Nervous system
   04726 Serotonergic synapse
    13095 (Cyp2c29)
  Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    13095 (Cyp2c29)
 Human Diseases
  Cancers
   05204 Chemical carcinogenesis
    13095 (Cyp2c29)
Enzymes [BR:mmu01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     13095 (Cyp2c29)
Cytochrome P450 [BR:mmu00199]
 Cytochrome P450, animal type
  CYP2 family
   13095 (Cyp2c29)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
19 D2; 19 33.91 cM
AA seq 490 aa AA seqDB search
MDLVVFLALTLSCLILLSLWRQSSGRGKLPPGPTPLPIIGNFLQIDVKNISQSFTNFSKA
YGPVFTLYLGSKPTVILHGYEAVKEALIDRGEEFAGRGSFPMAEKIIKGFGVVFSNGNRW
KEMRRFTLMTLRNLGMGKRNIEDRVQEEAQCLVEELRKTKGSPCDPTFILSCAPCNVICS
IIFQNRFDYKDKEFLILMDKINENVKILSSPWLQVCNSFPSLIDYCPGSHHKIVKNFNYL
KSYLLEKIKEHKESLDVTNPRDFIDYYLIKQKQVNHIEQSEFSLENLASTINDLFGAGTE
TTSTTLRYALLLLLKYPDVTAKVQEEIDRVVGRHRSPCMQDRSHMPYTDAMIHEVQRFID
LLPTSLPHAVTCDIKFRKYLIPKGTTVITSLSSVLHDSKEFPNPEMFDPGHFLNGNGNFK
KSDYFMPFSTGKRICAGEGLARMELFLILTTILQNFKLKSLVHPKEIDITPVMNGFASLP
PPYQLCFIPL
NT seq 1473 nt NT seq  +upstreamnt  +downstreamnt
atggatctggtcgtgttcctagcgctcactctatcctgtcttattctcctctcactatgg
agacagagctctgggagagggaagctccctcctggccccacgcctctcccaattattggt
aacttcctccagatagatgtgaagaacatcagccaatccttcaccaacttctcaaaagct
tatggccctgtgttcactctgtatttgggctcaaagcctactgtcatattgcatgggtat
gaagcagtgaaggaagctctgattgatcgtggggaggagtttgctggtagaggaagcttt
ccaatggctgaaaaaattattaaaggttttggcgttgtttttagcaatggaaacagatgg
aaagagatgagacgatttacactcatgaccctgcgaaatttgggcatggggaaaaggaac
attgaggaccgtgttcaagaggaagcacagtgtcttgtggaagaactgaggaaaaccaaa
ggctcaccctgtgaccccaccttcatcctgagctgtgctccatgcaatgtcatctgctca
attattttccagaatcgttttgattataaggataaggaatttcttatcctcatggataaa
ataaatgagaatgtcaagattctgagctccccatggttgcaggtctgcaatagtttccct
tcactcattgactattgtcctggaagtcatcacaaaatagtaaaaaattttaattatcta
aaaagttatttgttggagaaaataaaagaacacaaggaatcactggatgttacaaacccc
cgtgactttattgattattacctaattaaacaaaaacaggtaaaccacattgaacaatca
gagttttcacttgaaaatctggcaagcactatcaatgacctctttggtgcagggacagag
accacaagcacaacactgagatatgctctcctactcctgctgaagtacccagatgtcaca
gctaaagtccaggaagagattgaccgtgtggttggcaggcaccgcagcccctgcatgcaa
gacaggagccacatgccctatacagacgccatgattcatgaggtccagagattcatcgac
ctcctccccactagcctgcctcatgcagtgacctgtgacattaaattcaggaaatacctc
atccccaagggaactacagtaataacatcactgtcatcagtgctgcatgacagcaaggag
tttcccaacccagagatgtttgaccctgggcactttctaaatgggaatggaaactttaag
aaaagtgactacttcatgcctttttcaacaggaaaacggatttgtgctggagagggcctg
gcccgcatggagctgtttctaatcctgacaaccattttacagaacttcaaactgaaatct
ctggtccacccaaaagaaattgatattaccccagtgatgaatggatttgcctctctgcca
cccccttaccagctctgcttcattcctctctaa

DBGET integrated database retrieval system