KEGG   Mus musculus (mouse): 13097Help
Entry
13097             CDS       T01002                                 

Gene name
Cyp2c38
Definition
(RefSeq) cytochrome P450, family 2, subfamily c, polypeptide 38
  KO
K07413  cytochrome P450 family 2 subfamily C [EC:1.14.14.1]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00140  Steroid hormone biosynthesis
mmu00590  Arachidonic acid metabolism
mmu00591  Linoleic acid metabolism
mmu00830  Retinol metabolism
mmu01100  Metabolic pathways
mmu04726  Serotonergic synapse
mmu04750  Inflammatory mediator regulation of TRP channels
mmu05204  Chemical carcinogenesis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Metabolism
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    13097 (Cyp2c38)
   00590 Arachidonic acid metabolism
    13097 (Cyp2c38)
   00591 Linoleic acid metabolism
    13097 (Cyp2c38)
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    13097 (Cyp2c38)
 Organismal Systems
  Nervous system
   04726 Serotonergic synapse
    13097 (Cyp2c38)
  Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    13097 (Cyp2c38)
 Human Diseases
  Cancers
   05204 Chemical carcinogenesis
    13097 (Cyp2c38)
Enzymes [BR:mmu01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     13097 (Cyp2c38)
Cytochrome P450 [BR:mmu00199]
 Cytochrome P450, animal type
  CYP2 family
   13097 (Cyp2c38)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: p450 Pr_beta_C
Motif
Other DBs
NCBI-GeneID: 13097
NCBI-ProteinID: NP_034132
MGI: 1306819
Ensembl: ENSMUSG00000032808
Vega: OTTMUSG00000028396
UniProt: P56655
Position
19; 19 C3
AA seq 490 aa AA seqDB search
MDLVTFLVLTLSSLILLSLWRQRSRRGRLPPGPTPFPIIGNFLQIDVKNFNQSLTNFSKT
YGPVFTLYLGSRPIVVLHGYEAVKEALIDHGEEFSGRENIPMSEKINNGLGITFSNGNSW
KETRRFTLMTLRNLGMGKRNIEDRVREEAQCLVEELRKTKGSPCDPTFILSCAPCNVICS
IIFQDRFDYKDKDFLMLMKKLNENVKILSSPWLQVCNNFPLLIDYCPGSHHKVLKNFKYI
RSYLLEKVKEHQESLDVTNPRDFIDYFLIKQKQANHIEQAEYSLENLVCTINNLFAAGTE
TTSTTLRYALLLLMKYPDVTAKVQEEIDHVVGRHRSPCMQDRSRMPYTDAMIHEVQRFIN
LVPNNLPHAVTCDIKFRNYIIPKGTTVVTSLTSVLHDSKEFPNPEMFDPGHFLDANGNFK
KSDYFMTFSAGKRVCAGEGLARMELFLILTTILQNFKLKSLVHPKDIDMIPFVNGLITLP
PHYQLCFIPL
NT seq 1473 nt NT seq  +upstreamnt  +downstreamnt
atggatcttgtcacattcctggtgctcactctctcctctctcattctcctctcactatgg
agacagaggtctagaagagggaggctccctcctggccccactcctttcccgattattggt
aatttccttcagattgatgtgaagaacttcaaccaatccttaaccaatttctcaaaaacc
tatggccccgttttcactctgtatttgggctcacggcccattgttgtattgcatgggtat
gaagcagtgaaggaagctctgattgatcatggggaggagttttctggtagagaaaacatc
ccaatgtctgaaaagattaataatggccttggcattacttttagcaatggaaacagttgg
aaagagacaagacgtttcacactcatgaccctaaggaatttgggcatggggaaaaggaac
attgaggatcgtgttcgagaagaagcacagtgtcttgtggaagaactaaggaaaaccaag
ggctcaccttgtgaccccacattcattctgagctgtgctccatgcaatgtcatctgctca
attatttttcaagatcgttttgattacaaggataaagattttcttatgctcatgaaaaaa
ctaaatgagaatgtcaagattctgagctccccatggttgcaggtctgcaataatttcccc
ttgctcattgactattgtccgggaagtcatcacaaagtactaaaaaacttcaaatatatt
agaagttacctgttggagaaagtaaaagaacaccaagaatcactggatgttacaaaccct
cgtgactttatcgattatttcctgattaaacaaaaacaggcaaaccacatcgaacaagca
gaatattcacttgaaaatctggtctgcactatcaataatctctttgctgcaggaacagag
acaacaagcacaacactgagatatgctctcctactcctgatgaagtacccagatgtcaca
gctaaagtccaagaagagattgaccatgtggttggtagacaccgtagcccctgcatgcag
gacaggagccgcatgccctatactgatgccatgattcatgaggtccagagattcatcaac
cttgtccctaacaacctaccccatgcagtgacctgtgacattaaattcagaaactacatc
atccccaagggaacaacagtagtaacgtcactgacatcagttctgcatgacagcaaggag
ttccccaacccagagatgtttgaccctggccactttctagacgctaatggaaactttaag
aaaagtgactacttcatgactttctcagcaggaaaacgggtttgtgctggagagggcctg
gcccgcatggagctgtttctaatcctgaccaccattttacagaactttaaactgaaatct
ctggttcacccaaaagacattgatatgatcccatttgtgaatggattaatcactctgcca
ccccattaccagctctgcttcattcctctctaa

DBGET integrated database retrieval system