KEGG   Mus musculus (mouse): 13101Help
Entry
13101             CDS       T01002                                 

Gene name
Cyp2d10, AI303445, Cyp2d, P450-2D
Definition
cytochrome P450, family 2, subfamily d, polypeptide 10 (EC:1.14.14.1)
Orthology
K07414  
cytochrome P450, family 2, subfamily D [EC:1.14.14.1]
Organism
mmu  Mus musculus (mouse)
Pathway
Steroid hormone biosynthesis
Serotonergic synapse
Class
Metabolism; Lipid metabolism; Steroid hormone biosynthesis [PATH:mmu00140]
Organismal Systems; Nervous system; Serotonergic synapse [PATH:mmu04726]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
UniProt: 
Position
15 E1; 15 38.58 cM
AA seq 504 aa AA seqDB search
MELLTGAGLWSVAIFTVIFILLVDLMHRHQRWTSRYPPGPVPWPVLGNLLQVDLDNMPYS
LYKLQNRYGDVFSLQMGWKPMVVINGLKAMKEVLLTCGEDTADRPQVPIFEYLGVKPGSQ
GVVLAPYGPEWREQRRFSVSTLRNFGLGKKSLEDWVTKEARHLCDAFTAQAGQPINPNTM
LNNAVCNVIASLIFARRFEYEDPYLIRMQKVLEDSLTEISGLIPEVLNMFPILLRIPGLP
GKVFQGQKSLLAIVENLLTENRNTWDPDQPPRNLTDAFLAEIEKVKGNAESSFNDENLRM
VVLDLFTAGMVTTSTTLSWALLLMILHPDVQRRVQQEIDAVIGQVRHPEMADQARMPYTN
AVIHEVQRFGDIAPLNLPRITSRDIEVQDFLIPKGSILIPNMSSVLKDETVWEKPLRFHP
EHFLDAQGHFVKPEAFMPFSAGRRSCLGEPLARMELFLFFTCLLQHFSFSVPNGQPRPRN
LGVFPFPVAPYPYQLCAVMREQGH
NT seq 1515 nt NT seq  +upstreamnt  +downstreamnt
atggagctgctgactggggctggcctgtggtctgtggccatattcaccgttatcttcata
ttactggtggacctgatgcaccggcaccagcgctggacttctcgctacccaccgggccct
gtgccatggcctgtgctgggtaacctgctgcaggtggacctggataacatgccatacagc
ttgtacaagcttcaaaaccgctatggtgacgtgttcagcctgcagatgggctggaagcct
atggttgtgatcaatggactgaaggcaatgaaggaagtgctgttgacctgtggagaggac
actgctgaccgccctcaagtgcccatctttgagtacctgggtgtgaagcctggatcccaa
ggtgtggtccttgcaccctacgggcccgagtggcgagagcagaggcgattctctgtgtct
accctgcgcaactttggcctgggcaagaaatcactggaggactgggtgaccaaggaggcc
agacacctctgtgatgccttcaccgcccaggctgggcagcccatcaatcccaacaccatg
ctgaacaacgctgtgtgcaatgtgattgcatctctcatttttgcccgtcgctttgaatat
gaagacccttacctcatcaggatgcagaaagtactggaagatagtttgacagaaatctct
ggcttaattcctgaggttcttaatatgttccccatactcctgcgcatcccaggactgcct
gggaaggtcttccaaggtcagaagtccttactggccatagtggagaatctgttgactgag
aataggaacacctgggaccctgaccagccaccccgaaatttgactgatgccttcctggca
gagatagagaaggtaaaggggaatgctgagagcagcttcaatgatgagaacctgcgcatg
gttgtgctagacctgttcactgcagggatggtgaccacctcaaccacactgtcctgggcc
ctgctgctcatgatcctgcatccggatgtgcagcgcagagtccaacaggaaatcgatgcg
gtcatagggcaggtgcggcatccagagatggcagaccaggctcgtatgccctacaccaat
gctgtcattcatgaggtacagcgctttggggacattgctccactgaatttgccacgcatc
acaagtcgtgacattgaagtgcaggacttcctcatccccaaggggtcaatcctcatcccc
aacatgtcctccgtgctgaaggatgagactgtctgggaaaagcccctccgcttccatcct
gaacacttcctcgatgcccagggccactttgtgaagcctgaggccttcatgccattctca
gcaggccgcagatcatgcctgggtgagcccctggcccgcatggagctcttcctcttcttc
acgtgcctcctgcagcactttagcttctcagtgcccaatggacagcccaggcctagaaac
cttggtgtctttccttttccggttgccccctacccctaccagctctgtgctgtgatgcgt
gagcaaggacactaa

DBGET integrated database retrieval system