KEGG   Mus musculus (mouse): 13101Help
Entry
13101             CDS       T01002                                 

Gene name
Cyp2d10, AI303445, Cyp2d, P450-2D
Definition
cytochrome P450, family 2, subfamily d, polypeptide 10 (EC:1.14.14.1)
Orthology
K07414  
cytochrome P450, family 2, subfamily D [EC:1.14.14.1]
Organism
mmu  Mus musculus (mouse)
Pathway
Steroid hormone biosynthesis
Serotonergic synapse
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Metabolism
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    13101 (Cyp2d10)
 Organismal Systems
  Nervous system
   04726 Serotonergic synapse
    13101 (Cyp2d10)
Enzymes [BR:mmu01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     13101 (Cyp2d10)
Cytochrome P450 [BR:mmu00199]
 Cytochrome P450, animal type
  CYP2 family
   13101 (Cyp2d10)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
UniProt: 
Position
15 E1; 15 38.58 cM
AA seq 504 aa AA seqDB search
MELLTGAGLWSVAIFTVIFILLVDLMHRHQRWTSRYPPGPVPWPVLGNLLQVDLDNMPYS
LYKLQNRYGDVFSLQMGWKPMVVINGLKAMKEVLLTCGEDTADRPQVPIFEYLGVKPGSQ
GVVLAPYGPEWREQRRFSVSTLRNFGLGKKSLEDWVTKEARHLCDAFTAQAGQPINPNTM
LNNAVCNVIASLIFARRFEYEDPYLIRMQKVLEDSLTEISGLIPEVLNMFPILLRIPGLP
GKVFQGQKSLLAIVENLLTENRNTWDPDQPPRNLTDAFLAEIEKVKGNAESSFNDENLRM
VVLDLFTAGMVTTSTTLSWALLLMILHPDVQRRVQQEIDAVIGQVRHPEMADQARMPYTN
AVIHEVQRFGDIAPLNLPRITSRDIEVQDFLIPKGSILIPNMSSVLKDETVWEKPLRFHP
EHFLDAQGHFVKPEAFMPFSAGRRSCLGEPLARMELFLFFTCLLQHFSFSVPNGQPRPRN
LGVFPFPVAPYPYQLCAVMREQGH
NT seq 1515 nt NT seq  +upstreamnt  +downstreamnt
atggagctgctgactggggctggcctgtggtctgtggccatattcaccgttatcttcata
ttactggtggacctgatgcaccggcaccagcgctggacttctcgctacccaccgggccct
gtgccatggcctgtgctgggtaacctgctgcaggtggacctggataacatgccatacagc
ttgtacaagcttcaaaaccgctatggtgacgtgttcagcctgcagatgggctggaagcct
atggttgtgatcaatggactgaaggcaatgaaggaagtgctgttgacctgtggagaggac
actgctgaccgccctcaagtgcccatctttgagtacctgggtgtgaagcctggatcccaa
ggtgtggtccttgcaccctacgggcccgagtggcgagagcagaggcgattctctgtgtct
accctgcgcaactttggcctgggcaagaaatcactggaggactgggtgaccaaggaggcc
agacacctctgtgatgccttcaccgcccaggctgggcagcccatcaatcccaacaccatg
ctgaacaacgctgtgtgcaatgtgattgcatctctcatttttgcccgtcgctttgaatat
gaagacccttacctcatcaggatgcagaaagtactggaagatagtttgacagaaatctct
ggcttaattcctgaggttcttaatatgttccccatactcctgcgcatcccaggactgcct
gggaaggtcttccaaggtcagaagtccttactggccatagtggagaatctgttgactgag
aataggaacacctgggaccctgaccagccaccccgaaatttgactgatgccttcctggca
gagatagagaaggtaaaggggaatgctgagagcagcttcaatgatgagaacctgcgcatg
gttgtgctagacctgttcactgcagggatggtgaccacctcaaccacactgtcctgggcc
ctgctgctcatgatcctgcatccggatgtgcagcgcagagtccaacaggaaatcgatgcg
gtcatagggcaggtgcggcatccagagatggcagaccaggctcgtatgccctacaccaat
gctgtcattcatgaggtacagcgctttggggacattgctccactgaatttgccacgcatc
acaagtcgtgacattgaagtgcaggacttcctcatccccaaggggtcaatcctcatcccc
aacatgtcctccgtgctgaaggatgagactgtctgggaaaagcccctccgcttccatcct
gaacacttcctcgatgcccagggccactttgtgaagcctgaggccttcatgccattctca
gcaggccgcagatcatgcctgggtgagcccctggcccgcatggagctcttcctcttcttc
acgtgcctcctgcagcactttagcttctcagtgcccaatggacagcccaggcctagaaac
cttggtgtctttccttttccggttgccccctacccctaccagctctgtgctgtgatgcgt
gagcaaggacactaa

DBGET integrated database retrieval system