KEGG   Mus musculus (mouse): 13105Help
Entry
13105             CDS       T01002                                 

Gene name
Cyp2d9, Cyp2d, P450-2D
Definition
cytochrome P450, family 2, subfamily d, polypeptide 9 (EC:1.14.14.1)
Orthology
K07414  
cytochrome P450, family 2, subfamily D [EC:1.14.14.1]
Organism
mmu  Mus musculus (mouse)
Pathway
Steroid hormone biosynthesis
Serotonergic synapse
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Metabolism
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    13105 (Cyp2d9)
 Organismal Systems
  Nervous system
   04726 Serotonergic synapse
    13105 (Cyp2d9)
Enzymes [BR:mmu01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     13105 (Cyp2d9)
Cytochrome P450 [BR:mmu00199]
 Cytochrome P450, animal type
  CYP2 family
   13105 (Cyp2d9)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
UniProt: 
Position
15 E1; 15 38.6 cM
AA seq 504 aa AA seqDB search
MELLTGTDLWPVAIFTVIFILLVDLTHQRQRWTSRYPPGPVPWPVLGNLLQVDLGNMPYS
LYKLQNRYGDVFSLQMAWKPMVVINGLKAMKEMLLTCGEDTADRPPVPIFEYLGVKPGSQ
GVVLAPYGPEWREQRRFSVSTLRNFGLGKKSLEDWVTKEANHLCDAFTAQAGQPINPNPM
LNKSTCNVIASLIFARRFEYEDPFLIRMLKVLEQSLTEVSGLIPEVLNAFPILLRIPRLA
DKALQGQKSFIAILDNLLTENRTTWDPVQAPRNLTDAFLAEIEKAKGNPESSFNDENLLM
VVRDLFGAGMLTTSTTLSWALMLMILHPDVQRRVQQEIDEVIGQVRHPEMADQAHMPYTN
AVIHEVQRFGDIVPVNLPRITSHDIEVQDFLIPKGTILLPNMSSMLKDESVWEKPLRFHP
EHFLDAQGHFVKPEAFMPFSAGRRSCLGEALARMELFLFFTCLLQRFSFSVPDGQPQPSN
SGVYGILVAPSPYQLCAVVRDQGH
NT seq 1515 nt NT seq  +upstreamnt  +downstreamnt
atggagctgctgactgggactgacctgtggcctgtggccatattcacagtcatcttcata
ttactggtggacctgacccaccagcgccagcgctggacttctcgttacccaccaggccct
gtgccatggcctgtactgggtaacttgctgcaggtggacctaggtaacatgccatacagc
ttgtacaagcttcaaaaccgctatggtgacgtgttcagcctacagatggcctggaagcct
atggttgtgatcaatggactgaaggcaatgaaggaaatgctgttgacctgtggagaggac
actgctgaccgccctccagtgcccatctttgagtacctgggtgtgaagcctggatcccaa
ggtgtggtccttgcaccctacgggcccgagtggcgagagcagaggcgattctctgtgtct
accctgcgcaactttggcctgggcaagaaatcactggaggactgggtgaccaaggaggcc
aatcacctctgtgatgccttcaccgcccaggctgggcagcccatcaatcccaaccccatg
ctgaacaaatccacgtgcaatgtgattgcatctctcatttttgcccgtcgctttgaatat
gaagaccctttcctcatcaggatgctgaaagtactggaacaaagtttgacagaagtctct
ggcttaattcctgaggttcttaatgcattcccgatactcttgcgtatcccaaggctggct
gacaaggccctccaaggtcagaagtccttcatcgccatactggataacctgttgactgag
aataggaccacctgggaccctgtccaagcaccccgaaatttgactgatgccttcctggca
gagatagagaaggccaaagggaatcctgagagcagcttcaatgatgagaacctgctcatg
gtggtgcgtgacctgtttggtgcagggatgctgaccacctcaaccacattgtcctgggcc
ctgatgctcatgatcctgcatccagatgtgcagcgcagagtccaacaagaaatcgatgag
gtcatagggcaggtgaggcatccagagatggcagaccaggcccacatgccctacaccaat
gctgtcattcatgaggtgcagcgctttggggacattgttccagtgaatttgccacgcatc
acaagtcatgacattgaagtgcaggacttcctcatccccaaggggacgatcctcctcccc
aacatgtcctccatgctgaaagatgagtctgtctgggagaagcccctccgcttccatcct
gaacacttcctggatgcccagggccactttgtgaagcctgaggccttcatgccattctca
gcaggccgcagatcatgcctgggggaggccctggcccgcatggagcttttcctcttcttc
acctgcctcctgcagcgctttagcttctcagtgcctgatggacagccccagcccagcaac
tctggagtctatggtattcttgttgccccctctccctaccagctctgtgctgtggtacga
gaccaaggacactaa

DBGET integrated database retrieval system