KEGG   Mus musculus (mouse): 13107Help
Entry
13107             CDS       T01002                                 

Gene name
Cyp2f2, Cyp2f
Definition
cytochrome P450, family 2, subfamily f, polypeptide 2
Orthology
K07416  
cytochrome P450, family 2, subfamily F [EC:1.14.14.1]
Organism
mmu  Mus musculus (mouse)
Pathway
Metabolism of xenobiotics by cytochrome P450
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Metabolism
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    13107 (Cyp2f2)
Enzymes [BR:mmu01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     13107 (Cyp2f2)
Cytochrome P450 [BR:mmu00199]
 Cytochrome P450, animal type
  CYP2 family
   13107 (Cyp2f2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
7 A3; 7
AA seq 491 aa AA seqDB search
MDGVSTAILLLLLAVISLSLTFSSRGKGQLPPGPKPLPILGNLLQLRSQDLLTSLTKLSK
EYGSVFTVYLGSRPVIVLSGYQTVKEALVDKGEEFSGRGAYPVFFNFTRGNGIAFSDGER
WKILRRFSVQILRNFGMGKRSIEERILEEGSFLLEVLRKMEGKPFDPVFILSRSVSNIIC
SVVFGSRFDYDDERLLTIIHFINDNFKIMSSPWGEMYNIFPSVLDWIPGPHKRLFRNFGG
MKDLIARSVREHQDSLDPNSPRDFIDCFLTKMAQEKQDPLSHFNMDTLLMTTHNLLFGGT
ETVGTTLRHAFLILMKYPKVQARVQEEIDRVVGRSRMPTLEDRTSMPYTDAVIHEVQRFA
DVIPMNLPHRVTRDTPFRGFLIPKGTDVITLLNTVHYDSDQFKTPQEFNPEHFLDDNHSF
KKSPAFMPFSAGRRLCLGEPLARMELFIYFTSILQNFTLQPLVDPEDIDLTPLSSGLGNL
PRPFQLCMHIR
NT seq 1476 nt NT seq  +upstreamnt  +downstreamnt
atggatggtgtgagcacagccatcttgcttctcctcctggctgtcatctctctgtccctg
accttcagctcacggggcaagggccagctgcctccaggacccaaacctctcccaatcctg
ggaaacctgctgcagcttcgctcccaagacttgctgacctccctcaccaagcttagcaag
gagtatgggtcggtgttcacggtgtacctggggtccaggcctgtgatagtcctcagcgga
taccaaactgtgaaggaggctcttgtggacaaaggggaggagttcagtggccgaggcgca
taccccgtctttttcaacttcaccaggggcaacggcatcgccttctccgatggagagcgc
tggaagatcctcagaaggttctctgtccaaatcctgcggaactttggcatgggaaaaaga
agcatcgaggagcggatcctggaagaaggcagcttcctgctggaggtgctgaggaaaatg
gaaggcaagccctttgaccccgtgtttatcctgagccgctctgtgtccaacattatctgc
tctgtcgtcttcggaagtcgcttcgactatgacgatgagcgtctgctcaccatcatccac
tttatcaatgacaacttcaagattatgagcagcccttggggcgagatgtacaacatcttc
ccaagtgtccttgattggatacctgggccacacaaacgcttgttccggaactttggaggc
atgaaagatctcattgcccgcagcgtccgcgaacaccaggattccctggaccccaactct
ccccgggacttcatcgactgcttcctcacaaagatggcacaggagaagcaagacccactg
agccacttcaatatggataccctgctgatgaccacacacaacctgctcttcggtggcaca
gaaaccgtgggcaccacactgcgtcacgccttccttattcttatgaaataccccaaagtg
caagcccgcgtgcaggaagagattgaccgtgtggtggggcgctcgcggatgccgacgctg
gaagaccgtacatccatgccttacacagatgcagtgatccacgaagtgcaacgctttgct
gacgtcatccccatgaacctgcctcaccgtgtcactcgggacacacctttccggggcttc
ctgatacccaagggcacagatgtcatcacactccttaacactgtgcactacgactcggac
cagttcaagacgcctcaggagttcaatcctgaacattttctggacgacaatcattctttc
aaaaagagccccgccttcatgccattttcggctggacgtcgactgtgtctgggagagcca
ctggcgcgcatggagctcttcatatacttcacctccattctgcagaacttcacattgcag
ccgctggtggatcctgaggacatcgacctgaccccgctcagctcagggctgggcaatttg
ccaaggcctttccagctgtgtatgcacattcgctga

DBGET integrated database retrieval system