KEGG   Mus musculus (mouse): 13110Help
Entry
13110             CDS       T01002                                 

Gene name
Cyp2j6
Definition
cytochrome P450, family 2, subfamily j, polypeptide 6 (EC:1.14.14.1)
Orthology
K07418  
cytochrome P450, family 2, subfamily J [EC:1.14.14.1]
Organism
mmu  Mus musculus (mouse)
Pathway
Arachidonic acid metabolism
Linoleic acid metabolism
Metabolic pathways
Serotonergic synapse
Inflammatory mediator regulation of TRP channels
Ovarian steroidogenesis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    13110 (Cyp2j6)
   00591 Linoleic acid metabolism
    13110 (Cyp2j6)
 Organismal Systems
  Endocrine system
   04913 Ovarian Steroidogenesis
    13110 (Cyp2j6)
  Nervous system
   04726 Serotonergic synapse
    13110 (Cyp2j6)
  Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    13110 (Cyp2j6)
Enzymes [BR:mmu01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     13110 (Cyp2j6)
Cytochrome P450 [BR:mmu00199]
 Cytochrome P450, animal type
  CYP2 family
   13110 (Cyp2j6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
4 C5; 4 44.62 cM
AA seq 501 aa AA seqDB search
MLAATGSLLATIWAALHPRTLLVAAVTFLLLADYFKNRRPKNYPPGPWGLPFVGNIFQLD
FGQPHLSIQPLVKKYGNIFSLNLGDITSVVITGLPLIKEALTQMEQNIMNRPLSVMQERI
SNKNGLIFSSGQIWKEQRRFALMTLRNFGLGKKSLEERMQEEASHLVEAIREEEGKPFNP
HFSINNAVSNIICSVTFGERFDYHDSRFQEMLRLLDEVMYLETTMISQLYNIFPWIMKYI
PGSHQKVFRNWEKLKLFVSCMIDDHRKDWNPDEPRDFIDAFLKEMTKYPEKTTSFNEENL
ICSTLDLFFAGTETTSTTLRWALLYMALYPEVQEKVQAEIDRVIGQKRAARLADRESMPY
TNAVIHEVQRMGNIIPLNVPREVAMDTNLNGFHLPKGTMVLTNLTALHRDPKEWATPDVF
NPEHFLENGQFKKRESFLPFSMGKRACLGEQLARSELFIFFTSLMQKFTFNPPINEKLSP
KFRNGLTLSPVSHRICAVPRQ
NT seq 1506 nt NT seq  +upstreamnt  +downstreamnt
atgctcgctgctaccggctccttgttagccacgatctgggcagcgctccatcccaggact
ctgttggtggctgcagtcaccttcctgcttctggctgattacttcaaaaaccggcgcccc
aagaactatcccccagggccttggggtctgcctttcgtgggcaacatattccagttggac
tttgggcagccccacctctcaatccagccgttggtgaagaaatatgggaatatttttagc
ctgaatcttggtgacataacttcagtggtcataactggactgcccttaatcaaagaagca
cttactcaaatggaacaaaacattatgaatcgtcctctaagtgttatgcaagaacgtata
tctaataaaaatggattgatcttctccagtggccaaatatggaaggagcaaagaaggttt
gccctgatgacactgaggaactttggactgggaaagaagagcttagaggagcgcatgcag
gaggaggcctcccacctagtggaagccataagagaggaggaaggaaaacctttcaaccct
cacttcagtatcaacaatgcagtttccaatatcatttgctctgtcacctttggggagcgc
tttgactaccatgacagtagatttcaggagatgctgaggttactggacgaggttatgtat
ttggagacaacaatgattagtcagctgtataatatttttccatggataatgaaatacatc
cctggatcacatcaaaaagttttcagaaactgggaaaaactgaaattgtttgtctcttgt
atgattgatgatcaccggaaagactggaaccccgatgaaccaagagacttcattgatgct
ttcctcaaggaaatgacaaagtacccagagaagactacaagtttcaatgaagaaaacctt
atctgcagcactttggacctcttctttgctggaacagagacaacatcaactacattacgc
tgggctctgctctacatggccctctacccagaagtccaagaaaaagtacaggcagagatt
gatagggtgattggccagaagagggcagcaagacttgctgatagagaatccatgccctat
accaatgctgtcatccacgaggtgcagaggatgggcaatatcatccccttgaatgttccc
agggaagtagcaatggataccaatttgaatggatttcatctgccaaagggtacaatggtt
ctaacaaacctaactgcactgcacagagacccaaaagagtgggccactccagatgtgttc
aatccagagcactttttggagaatggacagtttaagaagagagaatcctttctgcccttc
tcaatgggaaagcgagcttgcctgggagaacaactggccaggtctgagctgttcattttc
ttcactagccttatgcaaaaattcaccttcaatcccccaatcaatgagaagctgagccca
aagttcagaaatggcctcacactttctccagtcagccaccgcatctgtgctgtccctaga
cagtga

DBGET integrated database retrieval system