KEGG   Mus musculus (mouse): 13112Help
Entry
13112             CDS       T01002                                 

Gene name
Cyp3a11, AI256190, Cyp3a, IIIAm1, Pcn
Definition
cytochrome P450, family 3, subfamily a, polypeptide 11 (EC:1.14.14.1)
Orthology
K07424  
cytochrome P450, family 3, subfamily A [EC:1.14.14.1]
Organism
mmu  Mus musculus (mouse)
Pathway
Steroid hormone biosynthesis
Linoleic acid metabolism
Retinol metabolism
Metabolic pathways
Chemical carcinogenesis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Metabolism
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    13112 (Cyp3a11)
   00591 Linoleic acid metabolism
    13112 (Cyp3a11)
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    13112 (Cyp3a11)
 Human Diseases
  Cancers
   05204 Chemical carcinogenesis
    13112 (Cyp3a11)
Enzymes [BR:mmu01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     13112 (Cyp3a11)
Cytochrome P450 [BR:mmu00199]
 Cytochrome P450, animal type
  CYP3 family
   13112 (Cyp3a11)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
5 G2; 5 85.17 cM
AA seq 504 aa AA seqDB search
MDLVSALSLETWVLLAISLVLLYRYGTRKHELFKKQGIPGPKPLPFLGTVLNYYKGLWKF
DMECYKKYGKTWGLFDGQTPLLAVTDPETIKNVLVKECFSVFTNRRDFGPVGIMSKAISI
SKDDEWKRYRALLSPTFTSGKLKEMFPVIEQYGDILVKYLRQKAKKGKPVTMKDVLGAYS
MDVITSTSFGVNVDSLNNPEDPFVEKAKKLLRFDFFDPLLFSVVLFPFLTPVYEMLNICM
FPKDSIEFFKKFVDRMKESRLDSKQKHRVDFLQLMMNSHNNSKDKVSHKALSDMEITAQS
IIFIFAGYETTSSTLSFTLHSLATHPDIQKKLQDEIDEALPNKAPPTYDTVMEMEYLDMV
LNETLRLYPIANRLERVCKKDVELNGVYIPKGSTVMIPSYALHHDPQHWSEPEEFQPERF
SKENKGSIDPYVYLPFGNGPRNCLGMRFALMNMKLALTKIMQNFSFQPCKETQIPLKLSR
QGLLQPEKPIVLKVVPRDAVITGA
NT seq 1515 nt NT seq  +upstreamnt  +downstreamnt
atggacctggtttcagctctctcactggaaacctgggtgctcctagcaatcagcttggtg
ctcctctaccgatatgggactcgtaaacatgaactttttaagaaacagggaattcctggg
cccaaacctctgccatttttaggcactgtgctgaattattacaagggtttatggaaattc
gacatggagtgctataaaaagtatggaaaaacatgggggttgtttgatggtcaaacgcct
ctccttgctgtcacagacccagagacgattaagaatgtgctagtgaaggaatgtttttct
gtcttcacaaaccggcgggattttggcccagtggggataatgagtaaagctatctcaata
tctaaggatgatgaatggaagagatatagagctttgctgtcccccacattcaccagtgga
aaactcaaggagatgttccctgtcattgaacagtatggagacattttggtaaagtacttg
aggcagaaggcaaagaaaggcaagcctgttactatgaaagatgtgttaggtgcttacagc
atggatgtgatcaccagcacatcatttggagtgaacgtggattccctcaacaacccagag
gatccttttgtggagaaagccaaaaagcttttaagatttgatttttttgatcctttgctc
ttctcagtagtactttttccattcctgacaccagtatatgagatgttaaatatctgcatg
ttcccaaaggattcaatagaatttttcaaaaaatttgtggacagaatgaaggaaagccgc
ctggattctaagcagaagcaccgagtggattttcttcagctgatgatgaattctcataat
aattccaaagacaaagtctctcataaagccctttctgacatggagatcacagcccagtca
attatctttatttttgctgggtatgaaaccaccagtagcacactttccttcaccctgcat
tccttggccactcaccctgatatccagaaaaaactgcaggatgagatcgatgaggctctg
cccaacaaggcacctcccacgtatgatactgtgatggagatggaatacctggatatggtg
cttaatgaaaccctcagattatatcccattgctaatagacttgagagagtctgtaagaaa
gatgttgaactcaatggtgtgtatatccccaaagggtcaacagtgatgattccatcttat
gctcttcaccatgacccacagcactggtcagagcctgaagaattccaacctgaaaggttc
agcaaggagaacaagggcagcattgatccttatgtatatctgccctttgggaatggaccc
aggaactgccttggcatgaggtttgctctcatgaatatgaaacttgctctcactaaaatt
atgcagaacttctccttccagccttgtaaggaaacacagatacctctgaaattaagcaga
caaggacttcttcaaccagaaaaacccattgttctaaaggttgtgccacgggatgcagtc
ataactggagcatga

DBGET integrated database retrieval system