KEGG   Mus musculus (mouse): 13114Help
Entry
13114             CDS       T01002                                 

Gene name
Cyp3a16
Definition
cytochrome P450, family 3, subfamily a, polypeptide 16 (EC:1.14.14.1)
Orthology
K07424  
cytochrome P450, family 3, subfamily A [EC:1.14.14.1]
Organism
mmu  Mus musculus (mouse)
Pathway
Steroid hormone biosynthesis
Linoleic acid metabolism
Retinol metabolism
Metabolic pathways
Chemical carcinogenesis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Metabolism
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    13114 (Cyp3a16)
   00591 Linoleic acid metabolism
    13114 (Cyp3a16)
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    13114 (Cyp3a16)
 Human Diseases
  Cancers
   05204 Chemical carcinogenesis
    13114 (Cyp3a16)
Enzymes [BR:mmu01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     13114 (Cyp3a16)
Cytochrome P450 [BR:mmu00199]
 Cytochrome P450, animal type
  CYP3 family
   13114 (Cyp3a16)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
5 G2; 5 85.17 cM
AA seq 504 aa AA seqDB search
MNLFSALSLDTLVLLAIILVLLYRYGTCTHGLFKKQGIPGPKPLPFLGTVLNYYKGLWKF
DMECYEKYGKTWGLFDGQIPLFVITDPETIKNVLVKECFSVFTNRQDFFPVGIMSKSISL
AKDEEWKRYRALLSPTFTSGNLKEMFPVIEQYGDILVKYLRQEAEKGKPVAVKDVLGAYS
MDVIISTTFGVNIDSLNNPEDPFVENAKKVLRFDYFDPLSLSVALFPFLTPIYEMLNICM
FPKDSIEFFKKFVDRMTENRLDSKQKHRVDFIYLMMEAYNKSKDKDSHKALSEIEITAQS
IIFIFAGYETTSSILSFTVYSLATHPDIQKKLQEEIDEALPNKAPPTYDTVMAMEYLDMV
LNETLRLYPITNRLQRVCKKDVEINGIYIPKGSTVIIPSYVLHHDPQHWPEPEEFQPERF
SKENKGSIDPYVYLPFGNGPRNCIGMRFALMNMKLALIKVLQNFSFQPCKETQIPLKLSR
ELLLQPVKPIVLKVVPRDAVITGA
NT seq 1515 nt NT seq  +upstreamnt  +downstreamnt
atgaacctattttcagcgctctcactggatacattggtcctcctggcaatcatcctggtg
ctcctctaccgatatgggacctgtacacatggactttttaagaaacagggaattcctggg
cccaaacctctgccatttttaggcactgtcctgaattattacaagggtttatggaaattt
gacatggagtgctatgaaaagtatggaaaaacgtgggggttgtttgatggtcaaatacct
ctctttgtcatcacggacccagagacgattaagaatgtgctagtgaaggaatgtttttct
gtcttcacaaaccggcaggattttttcccagtggggataatgagtaaatccatctctcta
gctaaagatgaggaatggaagagatatagagctttgctgtcccccacattcaccagtgga
aatctcaaggagatgtttcctgtcattgaacagtatggagacattttggtaaagtacttg
aggcaagaggcagagaaaggcaagcctgttgctgtgaaagatgtgttaggtgcctacagc
atggatgtgatcatcagcacaacatttggagtgaacatagattccctcaacaacccagag
gatccttttgtggagaatgccaagaaggttttaagatttgattattttgatcctttgtcc
ttgtcagtagcactctttccattcctcacaccaatatatgagatgttaaatatctgcatg
ttcccaaaggattcaatagaatttttcaaaaaatttgtggatagaatgacagaaaaccgc
ctggattctaagcagaagcaccgcgtggactttatttatctgatgatggaagcttataat
aagtcaaaagacaaagactctcataaagccctttctgaaatcgagatcacagcccagtca
attatttttatttttgctgggtatgaaaccaccagcagcatactttccttcaccgtgtat
tccttggccactcaccctgatatccagaagaaactgcaggaggagatcgatgaggctctg
cccaataaggcacctcccacctatgataccgtgatggcgatggaatacctggatatggtg
ctgaatgaaaccctcagattatatcccattactaatagacttcagagagtctgtaaaaag
gatgttgaaatcaatggtatttatatcccgaaagggtcaacagtgataattccatcttat
gttcttcaccatgacccacagcactggccagagcctgaagaattccaacctgaaaggttc
agcaaggagaacaagggcagcattgatccttatgtatatctgccctttgggaatggaccc
aggaactgcattggcatgaggtttgctctcatgaatatgaaacttgctctcattaaagtt
ctgcagaacttctccttccagccttgtaaggaaacacagatacctctgaaattaagcaga
gaactacttcttcaaccagtaaaacccattgttctaaaggttgtgccacgggatgcagtc
ataactggagcgtga

  All links  
No link information was found.   
DBGET integrated database retrieval system