KEGG   Mus musculus (mouse): 13114Help
Entry
13114             CDS       T01002                                 

Gene name
Cyp3a16
Definition
cytochrome P450, family 3, subfamily a, polypeptide 16 (EC:1.14.14.1)
Orthology
K07424  
cytochrome P450, family 3, subfamily A [EC:1.14.14.1]
Organism
mmu  Mus musculus (mouse)
Pathway
Steroid hormone biosynthesis
Linoleic acid metabolism
Retinol metabolism
Metabolic pathways
Chemical carcinogenesis
Class
Metabolism; Lipid metabolism; Steroid hormone biosynthesis [PATH:mmu00140]
Metabolism; Lipid metabolism; Linoleic acid metabolism [PATH:mmu00591]
Metabolism; Metabolism of cofactors and vitamins; Retinol metabolism [PATH:mmu00830]
Human Diseases; Cancers; Chemical carcinogenesis [PATH:mmu05204]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
5 G2; 5 85.17 cM
AA seq 504 aa AA seqDB search
MNLFSALSLDTLVLLAIILVLLYRYGTCTHGLFKKQGIPGPKPLPFLGTVLNYYKGLWKF
DMECYEKYGKTWGLFDGQIPLFVITDPETIKNVLVKECFSVFTNRQDFFPVGIMSKSISL
AKDEEWKRYRALLSPTFTSGNLKEMFPVIEQYGDILVKYLRQEAEKGKPVAVKDVLGAYS
MDVIISTTFGVNIDSLNNPEDPFVENAKKVLRFDYFDPLSLSVALFPFLTPIYEMLNICM
FPKDSIEFFKKFVDRMTENRLDSKQKHRVDFIYLMMEAYNKSKDKDSHKALSEIEITAQS
IIFIFAGYETTSSILSFTVYSLATHPDIQKKLQEEIDEALPNKAPPTYDTVMAMEYLDMV
LNETLRLYPITNRLQRVCKKDVEINGIYIPKGSTVIIPSYVLHHDPQHWPEPEEFQPERF
SKENKGSIDPYVYLPFGNGPRNCIGMRFALMNMKLALIKVLQNFSFQPCKETQIPLKLSR
ELLLQPVKPIVLKVVPRDAVITGA
NT seq 1515 nt NT seq  +upstreamnt  +downstreamnt
atgaacctattttcagcgctctcactggatacattggtcctcctggcaatcatcctggtg
ctcctctaccgatatgggacctgtacacatggactttttaagaaacagggaattcctggg
cccaaacctctgccatttttaggcactgtcctgaattattacaagggtttatggaaattt
gacatggagtgctatgaaaagtatggaaaaacgtgggggttgtttgatggtcaaatacct
ctctttgtcatcacggacccagagacgattaagaatgtgctagtgaaggaatgtttttct
gtcttcacaaaccggcaggattttttcccagtggggataatgagtaaatccatctctcta
gctaaagatgaggaatggaagagatatagagctttgctgtcccccacattcaccagtgga
aatctcaaggagatgtttcctgtcattgaacagtatggagacattttggtaaagtacttg
aggcaagaggcagagaaaggcaagcctgttgctgtgaaagatgtgttaggtgcctacagc
atggatgtgatcatcagcacaacatttggagtgaacatagattccctcaacaacccagag
gatccttttgtggagaatgccaagaaggttttaagatttgattattttgatcctttgtcc
ttgtcagtagcactctttccattcctcacaccaatatatgagatgttaaatatctgcatg
ttcccaaaggattcaatagaatttttcaaaaaatttgtggatagaatgacagaaaaccgc
ctggattctaagcagaagcaccgcgtggactttatttatctgatgatggaagcttataat
aagtcaaaagacaaagactctcataaagccctttctgaaatcgagatcacagcccagtca
attatttttatttttgctgggtatgaaaccaccagcagcatactttccttcaccgtgtat
tccttggccactcaccctgatatccagaagaaactgcaggaggagatcgatgaggctctg
cccaataaggcacctcccacctatgataccgtgatggcgatggaatacctggatatggtg
ctgaatgaaaccctcagattatatcccattactaatagacttcagagagtctgtaaaaag
gatgttgaaatcaatggtatttatatcccgaaagggtcaacagtgataattccatcttat
gttcttcaccatgacccacagcactggccagagcctgaagaattccaacctgaaaggttc
agcaaggagaacaagggcagcattgatccttatgtatatctgccctttgggaatggaccc
aggaactgcattggcatgaggtttgctctcatgaatatgaaacttgctctcattaaagtt
ctgcagaacttctccttccagccttgtaaggaaacacagatacctctgaaattaagcaga
gaactacttcttcaaccagtaaaacccattgttctaaaggttgtgccacgggatgcagtc
ataactggagcgtga

DBGET integrated database retrieval system