KEGG   Mus musculus (mouse): 13120Help
Entry
13120             CDS       T01002                                 

Gene name
Cyp4b1
Definition
cytochrome P450, family 4, subfamily b, polypeptide 1 (EC:1.14.14.1)
Orthology
K07426  
cytochrome P450, family 4, subfamily B, polypeptide 1 [EC:1.14.14.1]
Organism
mmu  Mus musculus (mouse)
Brite
Enzymes [BR:mmu01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     13120 (Cyp4b1)
Cytochrome P450 [BR:mmu00199]
 Cytochrome P450, animal type
  CYP4 family
   13120 (Cyp4b1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
4 D1; 4 53.06 cM
AA seq 511 aa AA seqDB search
MALSFLSPSLSRLGLWASVVILMVTVLKLLSLLFRRQKLARALDSFPGPPKHWLFGHALE
IQKTGGLDKVVTWTEQFPYAHPLWLGQFIVFLNIYEPDYAKAVYSRGDPKAAYVYDFFLQ
WIGKGLLVLEGPKWFQHRKLLTPGFHYDVLKPYVAIFAESTRVMLDKWEKKASENKSFDI
FCDVGHMALDTLMKCTFGKGDSGLSHSDNSYYLAVSDLTLLMQQRIDSFQYHNDFIYWLT
PHGRRFLRACQIAHDHTDHVIRQRKAALQDEKEQKKLQERRHLDFLDILLGARDESGIKL
SDADLRAEVDTFMFEGHDTTTSGISWFLYCMALYPMHQQRCREEVREILGDRDSFQWDDL
AQMTYLTMCMKECFRLYPPVPQVYRQLSKPVTFVDGRSLPAGSLISLHIYALHRNSAVWP
DPEVFDPLRFSPENMTGRHPFAFMPFSAGPRNCIGQQFAMNEMKVVTALCLLRFEFSPDP
SKIPIKVPQLILRSKNGIHLYLKPLGPGSGK
NT seq 1536 nt NT seq  +upstreamnt  +downstreamnt
atggcgctcagctttctctctccaagcctttcccgcctcggcctgtgggcttctgtagtg
atcctgatggtaaccgtcctgaagctcctcagcctgctgtttcggaggcagaagctggcc
agggctttggacagcttcccagggccccccaagcactggctttttggtcatgcccttgag
atccagaagacaggaggcctggacaaggtggtaacttggaccgaacagttcccctatgcc
cacccactctggcttggacaatttattgttttcctgaacatctatgagcctgactatgct
aaagctgtatacagccgaggggacccgaaggctgcatatgtgtatgacttcttcctccag
tggatcggaaaaggcctactggttctggaagggccaaaatggttccagcaccgcaagctg
ctcacacctggcttccattatgatgtgctgaagccctatgtggccatatttgctgagtcc
acacgggtgatgctggacaagtgggagaaaaaggctagtgagaataagagctttgacatc
ttctgtgacgtgggccacatggcactggacaccctcatgaagtgcacctttggcaaagga
gacagcggcctaagccacagtgacaacagctactacctggcagttagtgacctcacactg
ctgatgcagcagcgcatcgactccttccagtaccataatgacttcatttactggctcaca
ccacatggccgccgtttcttgcgggcctgccagatagcccatgaccatacagatcatgtc
atcaggcagcggaaggcagctctgcaggatgagaaggagcagaaaaagcttcaggagcgg
agacacctggacttcctcgacattctcctgggtgcccgggatgaaagtgggatcaagttg
tcagatgcagacctccgggctgaagtggacacattcatgttcgaaggccacgacaccacc
actagtggtatctcttggtttctctactgcatggccctttatcctatgcaccagcagcga
tgtagggaggaggtccgtgagatcctaggggaccgggactccttccagtgggatgatctg
gcccagatgacctacctgaccatgtgcatgaaggagtgcttccgcctctacccacctgta
ccccaagtgtaccgccagctcagcaagccagtaacctttgtggatggccgctctctacct
gcaggcagcctgatctctctgcacatctatgccctccatcggaacagtgctgtgtggcct
gacccagaggtctttgacccactgcgcttttctcctgagaatatgacaggacggcatccc
tttgccttcatgcctttttctgcagggcccaggaattgcattgggcagcagtttgctatg
aacgagatgaaggtggtcacagccctctgtttgctgcgctttgaattctctccagatccc
tcaaagatccccattaaggtcccccagctgatcttgcgctccaaaaatggcatccacctc
tacctgaagccactgggccctgggtctggaaagtag

DBGET integrated database retrieval system