KEGG   Mus musculus (mouse): 13142Help
Entry
13142             CDS       T01002                                 

Gene name
Dao, AI987963, DAAO, DAMOX, Dao-1, Dao1
Definition
D-amino acid oxidase (EC:1.4.3.3)
Orthology
K00273  
D-amino-acid oxidase [EC:1.4.3.3]
Organism
mmu  Mus musculus (mouse)
Pathway
Glycine, serine and threonine metabolism
Arginine and proline metabolism
D-Arginine and D-ornithine metabolism
Metabolic pathways
Peroxisome
Class
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:mmu00260]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:mmu00330]
Metabolism; Metabolism of other amino acids; D-Arginine and D-ornithine metabolism [PATH:mmu00472]
Metabolism; Biosynthesis of other secondary metabolites; Penicillin and cephalosporin biosynthesis
Cellular Processes; Transport and catabolism; Peroxisome [PATH:mmu04146]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
5 F; 5 55.93 cM
AA seq 345 aa AA seqDB search
MRVAVIGAGVIGLSTALCIHERYHPTQPLHMKIYADRFTPFTTSDVAAGLWQPYLSDPSN
PQEAEWSQQTFDYLLSCLHSPNAEKMGLALISGYNLFRDEVPDPFWKNAVLGFRKLTPSE
MDLFPDYGYGWFNTSLLLEGKSYLPWLTERLTERGVKLIHRKVESLEEVARGVDVIINCT
GVWAGALQADASLQPGRGQIIQVEAPWIKHFILTHDPSLGIYNSPYIIPGSKTVTLGGIF
QLGNWSGLNSVRDHNTIWKSCCKLEPTLKNARIVGELTGFRPVRPQVRLEREWLHFGSSS
AEVIHNYGHGGYGLTIHWGCAMEAANLFGKILEEKKLSRLPPSHL
NT seq 1038 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgtggccgtgatcggagcaggagtcattgggctctccacagccctctgcattcat
gagcgttaccacccaacacagccactgcacatgaagatctatgcagatcgattcaccccg
ttcaccacgagcgatgtggccgccggcctctggcagccttatctctctgaccccagcaac
cctcaggaggcggagtggagccagcaaacgtttgattacctgctgagctgcctccattct
ccaaacgctgaaaaaatgggcctggccctaatctcaggctacaacctcttccgagatgaa
gttccggaccctttctggaaaaacgcagttctgggattccggaagctgacccccagtgag
atggacctgttccctgattatggctacggctggttcaatacaagcctccttctagagggg
aagagctacctgccatggctaactgagaggttaactgagaggggagtgaagcttatccat
cggaaggtggagtctctcgaagaggtggcaagaggagtggatgtgattatcaactgcacc
ggggtgtgggccggggccctgcaagcagatgcctccctgcagccaggccggggccagatc
atccaggtggaggccccttggattaaacacttcatcctcacccatgatcctagccttggt
atctacaactctccgtacatcatcccaggttccaagacagttacgctcgggggtatattc
cagctggggaactggagcgggttaaacagcgtccgtgaccacaataccatttggaagagc
tgctgtaaactggagcccaccctgaagaatgcaagaattgtgggtgaactcactggcttc
cggccagtccggcctcaggtccggctagaaagagaatggcttcattttggatcttcaagt
gcagaggtcatccacaactatggtcatggaggttacgggctcacaatccactggggttgt
gcaatggaggcggccaacctcttcgggaaaattctagaggaaaagaagttgtccaggttg
cctccctcccacctctga

DBGET integrated database retrieval system