KEGG   Mus musculus (mouse): 13195Help
Entry
13195             CDS       T01002                                 

Gene name
Ddc, Aadc
Definition
(RefSeq) dopa decarboxylase (EC:4.1.1.28)
  KO
K01593  
aromatic-L-amino-acid decarboxylase [EC:4.1.1.28]
Organism
mmu  Mus musculus (mouse)
Pathway
Histidine metabolism
Tyrosine metabolism
Phenylalanine metabolism
Tryptophan metabolism
Metabolic pathways
Serotonergic synapse
Dopaminergic synapse
Cocaine addiction
Amphetamine addiction
Alcoholism
Module
Melatonin biosynthesis, tryptophan => serotonin => melatonin
Catecholamine biosynthesis, tyrosine => dopamine => noradrenaline => adrenaline
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Metabolism
  Amino acid metabolism
   00340 Histidine metabolism
    13195 (Ddc)
   00350 Tyrosine metabolism
    13195 (Ddc)
   00360 Phenylalanine metabolism
    13195 (Ddc)
   00380 Tryptophan metabolism
    13195 (Ddc)
 Organismal Systems
  Nervous system
   04728 Dopaminergic synapse
    13195 (Ddc)
   04726 Serotonergic synapse
    13195 (Ddc)
 Human Diseases
  Substance dependence
   05030 Cocaine addiction
    13195 (Ddc)
   05031 Amphetamine addiction
    13195 (Ddc)
   05034 Alcoholism
    13195 (Ddc)
Enzymes [BR:mmu01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.28  aromatic-L-amino-acid decarboxylase
     13195 (Ddc)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   13195 (Ddc)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
11 7.09 cM; 11 A1-A4
AA seq 480 aa AA seqDB search
MDSREFRRRGKEMVDYIADYLDGIEGRPVYPDVEPGYLRPLIPATAPQEPETYEDIIKDI
EKIIMPGVTHWHSPYFFAYFPTASSYPAMLADMLCGAIGCIGFSWAASPACTELETVMMD
WLGKMLELPEAFLAGRAGEGGGVIQGSASEATLVALLAARTKVIRQLQAASPEFTQAAIM
EKLVAYTSDQAHSSVERAGLIGGIKLKAVPSDGNFSMRASALREALERDKAAGLIPFFVV
ATLGTTSCCSFDNLLEVGPICNQEGVWLHIDAAYAGSAFICPEFRYLLNGVEFADSFNFN
PHKWLLVNFDCSAMWVKRRTDLTGAFNMDPVYLKHSHQDSGFITDYRHWQIPLGRRFRSL
KMWFVFRMYGVKGLQAYIRKHVELSHEFESLVRQDPRFEICTEVILGLVCFRLKGSNELN
ETLLQRINSAKKIHLVPCRLRDKFVLRFAVCARTVESAHVQLAWEHISDLASSVLRAEKE
NT seq 1443 nt NT seq  +upstreamnt  +downstreamnt
atggattcccgtgaattccggaggagaggcaaggagatggtggattatatagctgactat
ctggatggcattgagggtcgtccagtgtaccctgatgtggagcctggctatcttcggccc
ctgatccctgccactgccccccaggagccagaaacatacgaggacataatcaaagacatc
gagaagataatcatgccaggggtgacacactggcacagtccctatttcttcgcttacttc
cccacggctagctcatacccagctatgcttgcagacatgctgtgtggtgctattggctgc
attggtttctcctgggctgcaagcccagcgtgcacagagctggagaccgtgatgatggac
tggctggggaagatgctggagctgccagaggcctttttggctggaagagctggggaaggg
ggaggagtgatccagggaagtgccagtgaagccaccttggtggccctactggctgctcgg
actaaagttatccgccagctgcaggcagcctccccagagttcacacaagctgctatcatg
gaaaagctggttgcttacacatctgatcaggcgcattcctctgtagaaagagctgggtta
attggtggaataaagctaaaagcagtcccttcggatggcaacttttccatgagagcttct
gcccttcgggaagccctggagcgggacaaggcagctggcctgattccattctttgtggtc
gctacactggggaccacatcctgctgttcttttgacaatctcctggaagtgggtcccatc
tgcaaccaggagggtgtgtggctgcacattgacgctgcttacgcgggcagtgcctttatc
tgtcctgaattccggtatcttctgaatggtgtggagtttgcagattcctttaactttaat
ccccacaagtggcttttggtgaactttgactgctctgccatgtgggtgaagaggaggact
gacttaaccggagcctttaatatggaccctgtttatctaaagcacagtcaccaggactca
ggattcatcactgactacaggcactggcagatcccactggggcgacgatttcgctctttg
aaaatgtggtttgtttttagaatgtacggagtcaaggggctgcaggcttacatccgaaag
cacgtggagctgtctcatgagtttgagtcactggtacgccaggaccctcgctttgaaatt
tgcacagaagtcattcttgggttggtctgcttccggctaaagggctccaatgagttgaac
gaaactctcttacaaagaataaacagcgccaaaaaaatccacttggttccatgtcgtctc
cgagacaagtttgtgctacgctttgctgtgtgcgctcgcactgtggagtctgcccacgtg
cagctggcctgggaacacatcagtgatctagcaagcagtgtgctgagggcagagaaagaa
tga

DBGET integrated database retrieval system