KEGG   Mus musculus (mouse): 13195Help
Entry
13195             CDS       T01002                                 

Gene name
Ddc, Aadc
Definition
(RefSeq) dopa decarboxylase
  KO
K01593  aromatic-L-amino-acid/L-tryptophan decarboxylase [EC:4.1.1.28 4.1.1.105]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00350  Tyrosine metabolism
mmu00360  Phenylalanine metabolism
mmu00380  Tryptophan metabolism
mmu01100  Metabolic pathways
mmu04726  Serotonergic synapse
mmu04728  Dopaminergic synapse
mmu05030  Cocaine addiction
mmu05031  Amphetamine addiction
mmu05034  Alcoholism
Module
mmu_M00037  Melatonin biosynthesis, tryptophan => serotonin => melatonin
mmu_M00042  Catecholamine biosynthesis, tyrosine => dopamine => noradrenaline => adrenaline
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Metabolism
  Amino acid metabolism
   00350 Tyrosine metabolism
    13195 (Ddc)
   00360 Phenylalanine metabolism
    13195 (Ddc)
   00380 Tryptophan metabolism
    13195 (Ddc)
 Organismal Systems
  Nervous system
   04728 Dopaminergic synapse
    13195 (Ddc)
   04726 Serotonergic synapse
    13195 (Ddc)
 Human Diseases
  Substance dependence
   05030 Cocaine addiction
    13195 (Ddc)
   05031 Amphetamine addiction
    13195 (Ddc)
   05034 Alcoholism
    13195 (Ddc)
Enzymes [BR:mmu01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.28  aromatic-L-amino-acid decarboxylase
     13195 (Ddc)
    4.1.1.105  L-tryptophan decarboxylase
     13195 (Ddc)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   13195 (Ddc)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Beta_elim_lyase Aminotran_1_2 Autoind_bind
Motif
Other DBs
NCBI-GeneID: 13195
NCBI-ProteinID: NP_001177377
MGI: 94876
Ensembl: ENSMUSG00000020182
Vega: OTTMUSG00000005164
UniProt: O88533 Q5SUV8
Position
11 A1; 11 7.09 cM
AA seq 480 aa AA seqDB search
MDSREFRRRGKEMVDYIADYLDGIEGRPVYPDVEPGYLRPLIPATAPQEPETYEDIIKDI
EKIIMPGVTHWHSPYFFAYFPTASSYPAMLADMLCGAIGCIGFSWAASPACTELETVMMD
WLGKMLELPEAFLAGRAGEGGGVIQGSASEATLVALLAARTKVIRQLQAASPEFTQAAIM
EKLVAYTSDQAHSSVERAGLIGGIKLKAVPSDGNFSMRASALREALERDKAAGLIPFFVV
ATLGTTSCCSFDNLLEVGPICNQEGVWLHIDAAYAGSAFICPEFRYLLNGVEFADSFNFN
PHKWLLVNFDCSAMWVKRRTDLTGAFNMDPVYLKHSHQDSGFITDYRHWQIPLGRRFRSL
KMWFVFRMYGVKGLQAYIRKHVELSHEFESLVRQDPRFEICTEVILGLVCFRLKGSNELN
ETLLQRINSAKKIHLVPCRLRDKFVLRFAVCARTVESAHVQLAWEHISDLASSVLRAEKE
NT seq 1443 nt NT seq  +upstreamnt  +downstreamnt
atggattcccgtgaattccggaggagaggcaaggagatggtggattatatagctgactat
ctggatggcattgagggtcgtccagtgtaccctgatgtggagcctggctatcttcggccc
ctgatccctgccactgccccccaggagccagaaacatacgaggacataatcaaagacatc
gagaagataatcatgccaggggtgacacactggcacagtccctatttcttcgcttacttc
cccacggctagctcatacccagctatgcttgcagacatgctgtgtggtgctattggctgc
attggtttctcctgggctgcaagcccagcgtgcacagagctggagaccgtgatgatggac
tggctggggaagatgctggagctgccagaggcctttttggctggaagagctggggaaggg
ggaggagtgatccagggaagtgccagtgaagccaccttggtggccctactggctgctcgg
actaaagttatccgccagctgcaggcagcctccccagagttcacacaagctgctatcatg
gaaaagctggttgcttacacatctgatcaggcgcattcctctgtagaaagagctgggtta
attggtggaataaagctaaaagcagtcccttcggatggcaacttttccatgagagcttct
gcccttcgggaagccctggagcgggacaaggcagctggcctgattccattctttgtggtc
gctacactggggaccacatcctgctgttcttttgacaatctcctggaagtgggtcccatc
tgcaaccaggagggtgtgtggctgcacattgacgctgcttacgcgggcagtgcctttatc
tgtcctgaattccggtatcttctgaatggtgtggagtttgcagattcctttaactttaat
ccccacaagtggcttttggtgaactttgactgctctgccatgtgggtgaagaggaggact
gacttaaccggagcctttaatatggaccctgtttatctaaagcacagtcaccaggactca
ggattcatcactgactacaggcactggcagatcccactggggcgacgatttcgctctttg
aaaatgtggtttgtttttagaatgtacggagtcaaggggctgcaggcttacatccgaaag
cacgtggagctgtctcatgagtttgagtcactggtacgccaggaccctcgctttgaaatt
tgcacagaagtcattcttgggttggtctgcttccggctaaagggctccaatgagttgaac
gaaactctcttacaaagaataaacagcgccaaaaaaatccacttggttccatgtcgtctc
cgagacaagtttgtgctacgctttgctgtgtgcgctcgcactgtggagtctgcccacgtg
cagctggcctgggaacacatcagtgatctagcaagcagtgtgctgagggcagagaaagaa
tga

DBGET integrated database retrieval system