KEGG   Mus musculus (mouse): 13346Help
Entry
13346             CDS       T01002                                 

Gene name
Des
Definition
(RefSeq) desmin
  KO
K07610  
desmin
Organism
mmu  Mus musculus (mouse)
Pathway
Hypertrophic cardiomyopathy (HCM)
Arrhythmogenic right ventricular cardiomyopathy (ARVC)
Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Human Diseases
  Cardiovascular diseases
   05410 Hypertrophic cardiomyopathy (HCM)
    13346 (Des)
   05412 Arrhythmogenic right ventricular cardiomyopathy (ARVC)
    13346 (Des)
   05414 Dilated cardiomyopathy (DCM)
    13346 (Des)
Cytoskeleton proteins [BR:mmu04812]
 Eukaryotic cytoskeleton proteins
  Intermediate filaments
   Intermediate filaments
    Type III
     13346 (Des)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
1 38.85 cM; 1 C3
AA seq 469 aa AA seqDB search
MSQAYSSSQRVSSYRRTFGGAPGFSLGSPLSSPVFPRAGFGTKGSSSSMTSRVYQVSRTS
GGAGGLGSLRSSRLGTTRAPSYGAGELLDFSLADAVNQEFLATRTNEKVELQELNDRFAN
YIEKVRFLEQQNAALAAEVNRLKGREPTRVAELYEEEMRELRRQVEVLTNQRARVDVERD
NLIDDLQRLKAKLQEEIQLREEAENNLAAFRADVDAATLARIDLERRIESLNEEIAFLKK
VHEEEIRELQAQLQEQQVQVEMDMSKPDLTAALRDIRAQYETIAAKNISEAEEWYKSKVS
DLTQAANKNNDALRQAKQEMMEYRHQIQSYTCEIDALKGTNDSLMRQMRELEDRFASEAN
GYQDNIARLEEEIRHLKDEMARHLREYQDLLNVKMALDVEIATYRKLLEGEESRINLPIQ
TFSALNFRETSPEQRGSEVHTKKTVMIKTIETRDGEVVSEATQQQHEVL
NT seq 1410 nt NT seq  +upstreamnt  +downstreamnt
atgagccaggcctactcgtccagccagcgcgtgtcctcctaccgccgcaccttcggcggc
gccccgggcttctctctgggctccccgctgagctctcccgtgttccctcgagcaggcttc
ggtaccaagggctcctcgagttcaatgacatcccgcgtgtaccaggtgtcgcgcacgtcg
ggcggggctggaggcttggggtcgctgcggtctagccggctggggaccacccgagcgcca
tcctatggcgcgggcgagctgctggacttctccctggccgacgctgtgaaccaggagttc
ctggccacgcgcaccaacgagaaggtggagctgcaagagctcaatgaccgcttcgccaac
tacatcgagaaggtgcgcttcttggagcagcagaacgccgcgctcgccgccgaggtcaac
cggctcaagggccgcgaaccgactcgggtcgccgagctctacgaggaggagatgcgcgag
ctgcggcgccaggtggaggtgctcaccaaccagcgcgcccgggtcgacgtggagcgtgac
aacctgatagacgacctgcagaggctcaaggccaaactacaggaggaaatccaactaaga
gaagaagcagagaacaacttggctgccttccgagcggatgtggatgcagccactctagct
cgtattgacctggagcgcagaatcgaatccctcaacgaggagatcgcgttccttaagaaa
gtgcatgaagaggagatccgtgagcttcaggcccagcttcaggaacagcaggtccaggtg
gagatggacatgtccaagccggacctcacagctgccctcagggacatccgggctcagtat
gagaccatcgcggctaagaacatctctgaggctgaagaatggtacaagtccaaggtttca
gacttgactcaggcagccaataagaacaacgatgcgctgcgccaagccaagcaggagatg
atggaataccgacaccagatccagtcctacacctgcgagattgatgccctcaagggcacc
aacgactccctgatgaggcagatgagggagctggaggatcgctttgccagcgaggccaat
ggctatcaggacaacattgcgcgcctggaggaggagatccgacacctaaaggatgagatg
gcccgccatctgcgcgagtaccaggacctgctcaatgtgaagatggccttggatgtggag
atcgccacctaccggaagctactggagggcgaggagagcaggatcaaccttcctatccag
accttctctgctctcaacttccgagaaaccagccccgagcaaaggggttctgaagtccat
accaaaaagacagtgatgatcaagaccattgagacccgggatggagaggttgtcagcgag
gctacacagcaacaacatgaagtgctgtaa

DBGET integrated database retrieval system