KEGG   Mus musculus (mouse): 13360Help
Entry
13360             CDS       T01002                                 

Gene name
Dhcr7, AA409147
Definition
7-dehydrocholesterol reductase (EC:1.3.1.21)
Orthology
K00213  
7-dehydrocholesterol reductase [EC:1.3.1.21]
Organism
mmu  Mus musculus (mouse)
Pathway
Steroid biosynthesis
Metabolic pathways
Module
Cholesterol biosynthesis, squalene 2,3-epoxide => cholesterol
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Metabolism
  Lipid metabolism
   00100 Steroid biosynthesis
    13360 (Dhcr7)
Enzymes [BR:mmu01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.21  7-dehydrocholesterol reductase
     13360 (Dhcr7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
7; 7 F5
AA seq 471 aa AA seqDB search
MASKSQHNAPKVKSPNGKAGSQGQWGRAWEVDWFSLASIIFLLLFAPFIVYYFIMACDQY
SCSLTAPALDIATGHASLADIWAKTPPVTAKAAQLYALWVSFQVLLYSWLPDFCHRFLPG
YVGGVQEGAITPAGVVNKYEVNGLQAWLITHILWFVNAYLLSWFSPTIIFDNWIPLLWCA
NILGYAVSTFAMIKGYLFPTSAEDCKFTGNFFYNYMMGIEFNPRIGKWFDFKLFFNGRPG
IVAWTLINLSFAAKQQELYGHVTNSMILVNVLQAIYVLDFFWNETWYLKTIDICHDHFGW
YLGWGDCVWLPYLYTLQGLYLVYHPVQLSTPNALGILLLGLVGYYIFRMTNHQKDLFRRT
DGRCLIWGKKPKAIECSYTSADGLKHHSKLLVSGFWGVARHFNYTGDLMGSLAYCLACGG
GHLLPYFYIIYMTILLTHRCLRDEHRCANKYGRDWERYTAAVPYRLLPGIF
NT seq 1416 nt NT seq  +upstreamnt  +downstreamnt
atggcttcgaaatcccagcacaacgctcccaaagtcaagagtcccaacggcaaggctgga
tctcaaggacaatggggccgtgcctgggaagtggactggttctccctggccagcatcatt
ttcctgctgctcttcgctccattcattgtgtactacttcatcatggcatgtgaccagtac
agctgctccctgactgcccccgcattggatatagctacaggccatgctagtctggcagac
atttgggccaagacaccacctgtgacagctaaagctgcccaactgtatgccttgtgggtc
agcttccaggtgctgctttattcctggcttcctgacttctgccacagatttctgccaggt
tatgtgggaggcgtccaagaaggtgccattactccagcaggggttgtaaacaagtatgag
gtgaatgggctgcaagcctggctcattacccacatcctctggtttgtgaacgcttacctc
ttatcctggttctcccccaccatcatctttgacaactggatccccttgctatggtgtgcc
aacatcctgggctatgccgtgtccacgttcgcaatgatcaagggctacctgttccccacc
agtgccgaagactgcaaattcacaggcaatttcttctacaactatatgatgggaattgag
ttcaacccccgcatcgggaagtggtttgacttcaagctgttcttcaatggacgaccaggg
attgtagcctggaccctcattaacctgtccttcgctgccaagcagcaggagctttatggc
catgtgaccaactccatgattttggtcaatgtcttgcaggccatctacgtgttagacttc
ttctggaatgaaacctggtatctgaagaccatcgacatctgccatgaccactttgggtgg
tacctaggctggggagattgtgtgtggctgccctacctctacacactgcagggcctgtac
ttggtgtaccaccctgtgcagctctccacccccaatgccttgggcatcctgctgcttggc
ctcgtgggttactatatcttccgaatgaccaaccatcagaaggacctgttccgcaggaca
gatgggcgctgcctcatctggggcaagaagcccaaggccattgagtgctcctacacatca
gctgatgggctgaagcaccacagcaagctgttggtctcaggcttctggggtgtggcccgc
cacttcaactatactggtgacctgatgggcagccttgcctactgcctggcttgtggcggt
ggccacctcctcccctacttttacatcatctatatgactatcctgctcacccaccgctgc
ctccgtgatgaacaccgctgtgccaacaagtatggccgtgattgggagcgctacacagcc
gctgtgccctaccgcctgctgcctggaatcttctga

DBGET integrated database retrieval system