KEGG   Mus musculus (mouse): 13361Help
Entry
13361             CDS       T01002                                 

Gene name
Dhfr, 8430436I03Rik, AA607882, AI662710, AW555094
Definition
dihydrofolate reductase (EC:1.5.1.3)
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
mmu  Mus musculus (mouse)
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:mmu00790]
Metabolism; Metabolism of cofactors and vitamins; One carbon pool by folate [PATH:mmu00670]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
UniProt: 
Structure
PDB: 

Jmol
Position
13 C3; 13 47.64 cM
AA seq 187 aa AA seqDB search
MVRPLNCIVAVSQNMGIGKNGDLPWPPLRNEFKYFQRMTTTSSVEGKQNLVIMGRKTWFS
IPEKNRPLKDRINIVLSRELKEPPRGAHFLAKSLDDALRLIEQPELASKVDMVWIVGGSS
VYQEAMNQPGHLRLFVTRIMQEFESDTFFPEIDLGKYKLLPEYPGVLSEVQEEKGIKYKF
EVYEKKD
NT seq 564 nt NT seq  +upstreamnt  +downstreamnt
atggttcgaccattgaactgcatcgtcgccgtgtcccaaaatatggggattggcaagaac
ggagacctaccctggcctccgctcaggaacgagttcaagtacttccaaagaatgaccaca
acctcttcagtggaaggtaaacagaatctggtgattatgggtaggaaaacctggttctcc
attcctgagaagaatcgacctttaaaggacagaattaatatagttctcagtagagaactc
aaagaaccaccacgaggagctcattttcttgccaaaagtttggatgatgccttaagactt
attgaacaaccggaattggcaagtaaagtagacatggtttggatagtcggaggcagttct
gtttaccaggaagccatgaatcaaccaggccacctcagactctttgtgacaaggatcatg
caggaatttgaaagtgacacgtttttcccagaaattgatttggggaaatataaacttctc
ccagaatacccaggcgtcctctctgaggtccaggaggaaaaaggcatcaagtataagttt
gaagtctacgagaagaaagactaa

DBGET integrated database retrieval system