KEGG   Mus musculus (mouse): 13390Help
Entry
13390             CDS       T01002                                 

Gene name
Dlx1, Dlx, Dlx-1
Definition
distal-less homeobox 1
Orthology
K09314  
homeobox protein DLX1/4/6
Organism
mmu  Mus musculus (mouse)
Brite
Transcription factors [BR:mmu03000]
 Eukaryotic Type
  Helix-turn-helix
   Homeo domain only, Dll
    13390 (Dlx1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
2 C2; 2 42.61 cM
AA seq 255 aa AA seqDB search
MTMTTMPESLNSPVSGKAVFMEFGPPNQQMSPSPMSHGHYSMHCLHSAGHSQPDGAYSSA
SSFSRPLGYPYVNSVSSHASSPYISSVQSYPGSASLAQSRLEDPGADSEKSTVVEGGEVR
FNGKGKKIRKPRTIYSSLQLQALNRRFQQTQYLALPERAELAASLGLTQTQVKIWFQNKR
SKFKKLMKQGGAALEGSALANGRALSAGSPPVPPGWNPNSSSGKGSGSSAGSYVPSYTSW
YPSAHQEAMQQPQLM
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgaccatgaccaccatgccagaaagtctcaacagccccgtgtcgggcaaggctgtgttt
atggagtttgggccgcccaaccagcaaatgtctccttctcccatgtcccacgggcactac
tccatgcactgtttacactcggcgggccattcgcagcccgacggtgcctacagttcggcc
tcatccttctcccgaccgctgggctacccctacgtcaactcggtcagcagccacgcgtcc
agcccctacatcagttccgtgcagtcctaccccggcagcgccagcctcgcccagagccgc
ctggaggacccaggggcggactccgagaagagtacggtggtggaaggcggcgaggtgcgc
tttaacggcaaagggaaaaagatccgtaaacccaggacaatttattccagtttgcagttg
caggctttgaaccggaggttccaacaaactcagtacttagctctgcctgagagggcggag
ctggcggcctccttgggactcacacagacgcaggtcaagatatggttccagaacaaacgc
tccaagttcaagaagctgatgaagcaaggcggggcagctctggagggcagcgcgctggcg
aacggcagagccttgtctgccggctccccaccggtaccacccggctggaatccgaactcc
tcatctgggaagggctccggcagcagcgctggctcctacgtccccagctatacatcatgg
tatccctcagcgcaccaagaagctatgcagcagcctcaactgatgtga

DBGET integrated database retrieval system