KEGG   Mus musculus (mouse): 13390Help
Entry
13390             CDS       T01002                                 

Gene name
Dlx1, Dlx, Dlx-1
Definition
(RefSeq) distal-less homeobox 1
  KO
K09314  homeobox protein DLX1/4/6
Organism
mmu  Mus musculus (mouse)
Brite
Transcription factors [BR:mmu03000]
 Eukaryotic Type
  Helix-turn-helix
   Homeo domain only, Dll
    13390 (Dlx1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Homeobox Homeobox_KN Homez YdaS_antitoxin
Motif
Other DBs
NCBI-GeneID: 13390
NCBI-ProteinID: NP_034183
MGI: 94901
Ensembl: ENSMUSG00000041911
Vega: OTTMUSG00000013200
UniProt: Q64317
Position
2 C2; 2 42.61 cM
AA seq 255 aa AA seqDB search
MTMTTMPESLNSPVSGKAVFMEFGPPNQQMSPSPMSHGHYSMHCLHSAGHSQPDGAYSSA
SSFSRPLGYPYVNSVSSHASSPYISSVQSYPGSASLAQSRLEDPGADSEKSTVVEGGEVR
FNGKGKKIRKPRTIYSSLQLQALNRRFQQTQYLALPERAELAASLGLTQTQVKIWFQNKR
SKFKKLMKQGGAALEGSALANGRALSAGSPPVPPGWNPNSSSGKGSGSSAGSYVPSYTSW
YPSAHQEAMQQPQLM
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgaccatgaccaccatgccagaaagtctcaacagccccgtgtcgggcaaggctgtgttt
atggagtttgggccgcccaaccagcaaatgtctccttctcccatgtcccacgggcactac
tccatgcactgtttacactcggcgggccattcgcagcccgacggtgcctacagttcggcc
tcatccttctcccgaccgctgggctacccctacgtcaactcggtcagcagccacgcgtcc
agcccctacatcagttccgtgcagtcctaccccggcagcgccagcctcgcccagagccgc
ctggaggacccaggggcggactccgagaagagtacggtggtggaaggcggcgaggtgcgc
tttaacggcaaagggaaaaagatccgtaaacccaggacaatttattccagtttgcagttg
caggctttgaaccggaggttccaacaaactcagtacttagctctgcctgagagggcggag
ctggcggcctccttgggactcacacagacgcaggtcaagatatggttccagaacaaacgc
tccaagttcaagaagctgatgaagcaaggcggggcagctctggagggcagcgcgctggcg
aacggcagagccttgtctgccggctccccaccggtaccacccggctggaatccgaactcc
tcatctgggaagggctccggcagcagcgctggctcctacgtccccagctatacatcatgg
tatccctcagcgcaccaagaagctatgcagcagcctcaactgatgtga

DBGET integrated database retrieval system