KEGG   Mus musculus (mouse): 13409Help
Entry
13409             CDS       T01002                                 

Gene name
Tmc1, 4933416G09Rik, Beethoven, Bth, CWEA1, dn
Definition
(RefSeq) transmembrane channel-like gene family 1
Organism
mmu  Mus musculus (mouse)
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
UniProt: 
Position
19 B; 19 13.98 cM
AA seq 757 aa AA seqDB search
MLQIQVEEKEEDTEESSSEEEEDKLPRRESLRPKRKRTRDVINEDDPEPEPEDEETRKAR
EKERRRRLRRGAEEEEEIDEEELERLKALLDENRQMIATVKCKPWKMEKKIEVLKEAKKF
VSENEGALGKGKGKKWFAFKMMMAKKWAKFLRDFENFKAACVPWENKIKAIESQFGSSVA
SYFLFLRWMYGVNMVLFVLTFSLIMLPEYLWGLPYGSLPRKTVPRAEEASAANFGVLYDF
NGLAQYSVLFYGYYDNKRTIGWLNFRLPLSYFLVGIMCIGYSFLVVLKAMTKNIGDDGGG
DDNTFNFSWKVFCSWDYLIGNPETADNKFNSITMNFKEAIIEERAAQVEENIHLIRFLRF
LANFFVFLTLGASGYLIFWAVKRSQEFAQQDPDTLGWWEKNEMNMVMSLLGMFCPTLFDL
FAELEDYHPLIALKWLLGRIFALLLGNLYVFILALMDEINNKIEEEKLVKANITLWEANM
IKAYNESLSGLSGNTTGAPFFVHPADVPRGPCWETMVGQEFVRLTVSDVLTTYVTILIGD
FLRACFVRFCNYCWCWDLEYGYPSYTEFDISGNVLALIFNQGMIWMGSFFAPSLPGINIL
RLHTSMYFQCWAVMCCNVPEARVFKASRSNNFYLGMLLLILFLSTMPVLYMIVSLPPSFD
CGPFSGKNRMFEVIGETLEHDFPSWMAKILRQLSNPGLVIAVILVMVLTIYYLNATAKGQ
KAANLDLKKKMKQQALENKMRNKKMAAARAAAAAGGQ
NT seq 2274 nt NT seq  +upstreamnt  +downstreamnt
atgttgcaaatccaagtggaggagaaagaagaggatacagaggaaagctcaagtgaagaa
gaagaagataagctacccagaagagagagcttgagaccaaagaggaaacggaccagagat
gtcatcaatgaggatgacccagaaccggagccggaggatgaagaaacaagaaaggcaaga
gaaaaagaaaggcggaggaggctgcggagaggagcggaagaagaagaagaaattgatgaa
gaggaattagaacggttaaaagcactgctcgatgagaatagacaaatgatcgctactgtc
aaatgtaaaccttggaaaatggagaagaaaattgaagttctcaaggaagcaaagaaattt
gtgagtgagaatgaaggcgctcttgggaaaggaaagggaaagaagtggtttgcatttaag
atgatgatggccaagaaatgggcaaaattcctccgagattttgagaacttcaaagcggct
tgcgtcccatgggaaaacaaaatcaaggcaattgaaagtcagtttggttcctcagtggcc
tcgtacttcctgttcctcaggtggatgtacggcgtcaacatggttctctttgtgttgacc
ttcagcctcatcatgttaccggagtacctctggggtttaccgtacggcagcttacctagg
aaaacagtcccaagagctgaagaagcatctgcagccaactttggtgtgttgtatgacttc
aatggcctggcgcagtactctgtcctcttttatggctattacgacaataaacgcacgatc
ggatggctgaatttccggctacctctttcctacttcctggtggggattatgtgcattgga
tacagcttcctggttgtcctcaaagcgatgaccaaaaatattggtgacgatggtggtggc
gatgacaacactttcaacttcagctggaaggtgttctgtagctgggactatctgattggt
aaccctgaaacagccgacaacaagtttaactctatcacgatgaactttaaggaagccatc
atagaagagagagccgcacaggtggaggagaacatccacctcatcagatttctgaggttt
ctcgctaacttcttcgtgttcctcacacttggtgcaagtggatacctcatcttttgggct
gtgaagcgatcccaggagttcgcccagcaagatcctgacacccttgggtggtgggaaaaa
aatgaaatgaacatggtaatgtccctcctggggatgttctgtcccaccctgtttgactta
tttgctgaactggaagattaccatcctctcattgctctgaagtggctcctggggcgcatt
tttgctcttcttctaggcaacttgtatgtattcattctcgccttgatggatgagattaac
aacaagattgaagaggagaagcttgtgaaggccaatattaccctgtgggaagccaacatg
attaaggcttacaatgaatctctctctgggctctctgggaacaccacaggagcacccttt
ttcgttcatcctgcagatgtccctcgcggtccctgctgggaaacaatggtggggcaggaa
ttcgtgcgtctcaccgtttctgacgtcctgaccacttacgtcacgatcctcattggcgac
ttcctcagagcatgtttcgtgaggttctgcaattactgctggtgctgggacttagaatat
ggatatccttcatacacagaattcgacatcagtggcaacgtcctcgctctgatcttcaac
caaggcatgatctggatgggctccttcttcgctcctagcctcccgggcatcaacatcctc
cgtctccacacatccatgtatttccagtgctgggctgtgatgtgctgcaatgttcccgag
gccagggtgttcaaagcttccagatccaacaacttctacctcggcatgctgctactcatc
ctcttcctgtccaccatgccggtcctgtacatgatcgtctccctcccgccatcttttgat
tgtgggcccttcagtggtaaaaacaggatgtttgaagtcatcggtgagaccctggaacat
gacttcccaagctggatggcgaagatcctgaggcagctttctaaccccggccttgtcatt
gctgtcattctggtgatggtcctgaccatctattatctcaatgctactgccaagggccag
aaagcagcgaatctggacctcaaaaagaagatgaaacagcaagctttggagaacaaaatg
cgaaacaagaaaatggcagcggctcgagcagctgcagctgctggtggccagtaa

DBGET integrated database retrieval system