KEGG   Mus musculus (mouse): 13433Help
Entry
13433             CDS       T01002                                 

Gene name
Dnmt1, Cxxc9, Dnmt, Dnmt1o, MCMT, MTase, Met-1, Met1, MommeD2, m.MmuI
Definition
(RefSeq) DNA methyltransferase (cytosine-5) 1 (EC:2.1.1.37)
  KO
K00558  
DNA (cytosine-5)-methyltransferase 1 [EC:2.1.1.37]
Organism
mmu  Mus musculus (mouse)
Pathway
Cysteine and methionine metabolism
Metabolic pathways
MicroRNAs in cancer
Module
Methionine degradation
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Metabolism
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    13433 (Dnmt1)
 Human Diseases
  Cancers
   05206 MicroRNAs in cancer
    13433 (Dnmt1)
Enzymes [BR:mmu01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.37  DNA (cytosine-5-)-methyltransferase
     13433 (Dnmt1)
DNA replication proteins [BR:mmu03032]
 Eukaryotic Type
  DNA Replication Termination Factors
   DNA methylation enzymes
    13433 (Dnmt1)
Chromosome [BR:mmu03036]
 Eukaryotic Type
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    13433 (Dnmt1)
Prokaryotic defense system [BR:mmu02048]
 Restriction and modification system (R-M system)
  Type II R-M system
   DNA methyltransferases
    13433 (Dnmt1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
UniProt: 
Structure
PDB: 

Jmol
Position
9 A3; 9 7.66 cM
AA seq 1620 aa AA seqDB search
MPARTAPARVPALASPAGSLPDHVRRRLKDLERDGLTEKECVREKLNLLHEFLQTEIKSQ
LCDLETKLHKEELSEEGYLAKVKSLLNKDLSLENGTHTLTQKANGCPANGSRPTWRAEMA
DSNRSPRSRPKPRGPRRSKSDSDTLSVETSPSSVATRRTTRQTTITAHFTKGPTKRKPKE
ESEEGNSAESAAEERDQDKKRRVVDTESGAAAAVEKLEEVTAGTQLGPEEPCEQEDDNRS
LRRHTRELSLRRKSKEDPDREARPETHLDEDEDGKKDKRSSRPRSQPRDPAAKRRPKEAE
PEQVAPETPEDRDEDEREEKRRKTTRKKLESHTVPVQSRSERKAAQSKSVIPKINSPKCP
ECGQHLDDPNLKYQQHPEDAVDEPQMLTSEKLSIYDSTSTWFDTYEDSPMHRFTSFSVYC
SRGHLCPVDTGLIEKNVELYFSGCAKAIHDENPSMEGGINGKNLGPINQWWLSGFDGGEK
VLIGFSTAFAEYILMEPSKEYEPIFGLMQEKIYISKIVVEFLQNNPDAVYEDLINKIETT
VPPSTINVNRFTEDSLLRHAQFVVSQVESYDEAKDDDETPIFLSPCMRALIHLAGVSLGQ
RRATRRVMGATKEKDKAPTKATTTKLVYQIFDTFFSEQIEKYDKEDKENAMKRRRCGVCE
VCQQPECGKCKACKDMVKFGGTGRSKQACLKRRCPNLAVKEADDDEEADDDVSEMPSPKK
LHQGKKKKQNKDRISWLGQPMKIEENRTYYQKVSIDEEMLEVGDCVSVIPDDSSKPLYLA
RVTALWEDKNGQMMFHAHWFCAGTDTVLGATSDPLELFLVGECENMQLSYIHSKVKVIYK
APSENWAMEGGTDPETTLPGAEDGKTYFFQLWYNQEYARFESPPKTQPTEDNKHKFCLSC
IRLAELRQKEMPKVLEQIEEVDGRVYCSSITKNGVVYRLGDSVYLPPEAFTFNIKVASPV
KRPKKDPVNETLYPEHYRKYSDYIKGSNLDAPEPYRIGRIKEIHCGKKKGKVNEADIKLR
LYKFYRPENTHRSYNGSYHTDINMLYWSDEEAVVNFSDVQGRCTVEYGEDLLESIQDYSQ
GGPDRFYFLEAYNSKTKNFEDPPNHARSPGNKGKGKGKGKGKGKHQVSEPKEPEAAIKLP
KLRTLDVFSGCGGLSEGFHQAGISETLWAIEMWDPAAQAFRLNNPGTTVFTEDCNVLLKL
VMAGEVTNSLGQRLPQKGDVEMLCGGPPCQGFSGMNRFNSRTYSKFKNSLVVSFLSYCDY
YRPRFFLLENVRNFVSYRRSMVLKLTLRCLVRMGYQCTFGVLQAGQYGVAQTRRRAIILA
AAPGEKLPLFPEPLHVFAPRACQLSVVVDDKKFVSNITRLSSGPFRTITVRDTMSDLPEI
QNGASNSEIPYNGEPLSWFQRQLRGSHYQPILRDHICKDMSPLVAARMRHIPLFPGSDWR
DLPNIQVRLGDGVIAHKLQYTFHDVKNGYSSTGALRGVCSCAEGKACDPESRQFSTLIPW
CLPHTGNRHNHWAGLYGRLEWDGFFSTTVTNPEPMGKQGRVLHPEQHRVVSVRECARSQG
FPDSYRFFGNILDRHRQVGNAVPPPLAKAIGLEIKLCLLSSARESASAAVKAKEEAATKD
NT seq 4863 nt NT seq  +upstreamnt  +downstreamnt
atgccagcgcgaacagctccagcccgagtgcctgcgcttgcctccccggcaggctcgctc
ccggaccatgtccgcaggcggctcaaagacttggaaagagatggcttaacagaaaaggag
tgtgtgagggagaaattaaacttactgcatgaattcctgcaaacagaaataaaaagccag
ttgtgtgacttggaaaccaaattacataaagaggaattatctgaggaaggctacctggct
aaagtcaagtccctcttaaataaggatttgtccttggagaacggaacacacactctcact
caaaaagccaacggttgtcccgccaacgggagccggccaacctggagagcagaaatggca
gactcaaatagatccccaagatccaggcccaagcctcggggacccaggagaagcaagtcg
gacagtgacaccctttcagttgaaacttcacctagttccgtggctacgaggagaaccacc
aggcagaccaccatcacggctcacttcacgaagggccccactaaacggaaacccaaggaa
gagtcggaagaggggaactcggctgagtcggctgcagaggagagagaccaggataagaaa
cgcagagttgtagacacagagagtggtgctgcagctgctgtggagaaactggaagaggta
acagcgggaacccagctgggtccggaagagccatgtgaacaggaagatgacaacaggagt
cttcgacgtcacaccagagagctatcattgaggcggaaatcaaaggaggatccagacaga
gaagcaagaccggaaactcacttggacgaggacgaggacggaaaaaaggataaaagaagt
tccagacccaggagccagcccagagatccagctgccaaacggagacccaaggaagcagag
ccagagcaggtagctccagagactcccgaggacagagacgaggatgagagggaggagaag
agacgaaaaacgacacgtaaaaaactggagtcacacaccgttcccgttcagagcagatcg
gagagaaaagccgctcaaagcaaaagtgtgatcccgaagatcaactcaccaaagtgcccc
gagtgtggccagcacctagacgaccctaacctgaagtaccagcagcaccctgaggatgct
gtggatgaaccccagatgttgaccagtgagaaactgtccatctacgactccacctcgacc
tggtttgatacttatgaagattctcccatgcataggttcacttccttcagtgtgtactgc
agtcgcgggcacctgtgtcctgtcgacaccggtctcattgagaagaatgtagagctctac
ttttctgggtgtgccaaagcaattcatgacgagaatccatctatggaaggtggtattaat
ggcaaaaacctcgggccaatcaatcagtggtggctcagtggctttgatggtggcgagaag
gtgctcattggcttctccactgcatttgctgaatacattttgatggagcccagcaaagag
tatgagccaatatttgggctgatgcaggagaaaatttacatcagcaagattgttgttgag
ttcctgcaaaacaatcctgatgctgtatatgaagacctgatcaataagattgagaccact
gttcctccttctaccattaatgtgaaccggttcacagaggactccctcttacgccacgcc
cagtttgtagtgagccaggtagagagttacgacgaagccaaggacgatgatgagaccccc
atcttcttgtctccctgtatgagagccctgatccatttggctggtgtctccctgggacag
aggcgagcaacaaggcgcgtcatgggtgctaccaaggagaaggacaaagcacccacgaaa
gccaccaccaccaagctggtctatcagatctttgacactttcttctcagagcagattgag
aagtatgataaggaggacaaggagaatgccatgaagcgccgccgctgtggtgtctgtgag
gtctgtcagcagcctgagtgtgggaagtgcaaggcgtgcaaagatatggtgaagtttggt
ggcactggacggagtaagcaggcttgcctcaagaggaggtgtcctaacttggcggtgaag
gaggcagacgacgatgaagaggctgatgatgatgtgtcagagatgccatcacccaaaaag
ctgcatcaggggaagaagaagaagcagaacaaggaccgcatctcctggcttgggcagcct
atgaagattgaagagaatagaacttactatcagaaggtgagcatcgatgaggagatgcta
gaggtgggcgactgcgtctcggtcattccagatgattcctccaaaccactctatctagcc
agggtcacagctctgtgggaagacaaaaatggtcagatgatgttccatgcgcactggttc
tgcgctgggacagacacagtcctgggagccacctccgaccccctggaactgttcctggtg
ggcgagtgcgaaaacatgcagctttcctacatccacagcaaggtcaaggtcatctacaaa
gccccttctgaaaactgggccatggagggaggcacagaccctgagaccacactgcctggg
gctgaggatggcaagacttacttcttccagctctggtacaaccaggagtacgcaaggttt
gaatccccacccaagacccagccgaccgaggacaacaagcacaagttctgcctatcttgt
atccggctggctgagctgagacaaaaagaaatgcccaaggtcctggaacaaattgaggag
gtggatggccgggtctactgcagttccatcaccaagaatggtgttgtctaccgactgggt
gacagtgtgtaccttcctcccgaggcctttactttcaacatcaaagtggctagccccgtg
aaacgcccaaagaaggatcctgtgaacgagaccctgtaccctgagcactaccgcaagtat
tctgactacatcaaggggagcaacctggatgctccagagccctatcgcatcggtcggata
aaagagatccactgtggcaagaagaaaggcaaggtcaacgaggcagacatcaagctgagg
ctctacaagttctacaggcctgagaatacccacaggtcctacaacggatcctatcacact
gacatcaacatgctttactggagcgacgaggaagctgtggtgaacttcagcgacgtgcag
ggccgctgtaccgtggagtacggggaagacctacttgagagcatccaggattattcacaa
gggggccctgaccgcttctacttcctcgaggcctacaattcaaagaccaagaactttgaa
gacccaccaaaccatgcccgcagccctgggaacaaagggaaagggaaggggaaagggaag
gggaaggggaagcatcaggtgtcagagcccaaagagcctgaggcagccatcaaactgccc
aagctccggaccctggatgtgttttccggctgtggagggttatcggaaggattccaccaa
gcaggcatctcggaaacgctgtgggccatcgagatgtgggacccggcagcccaggcattt
cggctgaacaaccccggcaccacagtgttcacagaggactgcaacgtgcttcttaagctg
gtcatggctggggaggtgaccaactctctgggccaaaggctgccacagaagggcgatgtg
gagatgctgtgtggtgggccaccctgccagggcttcagtggcatgaaccgcttcaactcc
cgcacttactccaagttcaaaaactccctagtggtctccttcctcagctactgtgactac
taccggcctcggttcttccttctggagaacgtcaggaacttcgtgtcctacagacgctcc
atggtgctgaagctcacactgcgctgcctggtccgcatgggctaccagtgcacctttggt
gtgctccaggctggacagtatggcgtggcccagacacgaaggagggccatcatcttggct
gcagccccaggagaaaagctgcctctgttcccagagcctctgcatgtgtttgcgccccgt
gcctgccagctgagcgttgtggtggatgacaagaagtttgttagcaacataacgaggctg
agctcggggcccttccgaaccatcaccgtgcgagacaccatgtctgacctccccgagatc
cagaatggagcctcgaattctgagatcccctacaatggagagccactgtcctggttccag
aggcagctgcgaggatcacactaccagcccatcctcagggaccatatctgcaaggacatg
agcccactggtggctgcccgcatgcggcacatcccactgttcccaggatcagattggcgt
gacctgcccaacatacaggtgcggctgggagatggcgtcatagcccataagctacagtac
acctttcatgatgtgaaaaatggctacagcagcaccggtgccctgcgtggagtctgttcc
tgtgcagaaggcaaggcctgcgaccctgagtccaggcaattcagcaccctcatcccctgg
tgcctgccgcacactgggaaccggcacaaccactgggctggcctctacgggcgtctggag
tgggatggcttcttcagcaccactgtcaccaaccctgagcccatgggcaagcagggtcgg
gtgctccacccggagcagcaccgggtcgtgagtgttcgggaatgtgcccgctcccagggc
tttccagatagctaccggttcttcggcaacatcctggacagacaccggcaggtgggtaat
gctgtgccaccacccctggccaaagccattggcctggagattaagctctgcctgctgtcc
agtgctcgggagagcgcatcagctgcagttaaagcaaaagaggaggctgctaccaaggac
tag

DBGET integrated database retrieval system