KEGG   Mus musculus (mouse): 13531Help
Entry
13531             CDS       T01002                                 

Gene name
Usp17la, Dub1, USP17-A
Definition
(RefSeq) ubiquitin specific peptidase 17-like A (EC:3.4.19.12)
  KO
K11845  
ubiquitin carboxyl-terminal hydrolase 17 [EC:3.4.19.12]
Organism
mmu  Mus musculus (mouse)
Brite
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     13531 (Usp17la)
Peptidases [BR:mmu01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   13531 (Usp17la)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
7 E3; 7 55.69 cM
AA seq 526 aa AA seqDB search
MVVALSFPEADPALSSPDAPELHQDEAQVVEELTVNGKHSLSWESPQGPGCGLQNTGNSC
YLNAALQCLTHTPPLADYMLSQEHSQTCCSPEGCKLCAMEALVTQSLLHSHSGDVMKPSH
ILTSAFHKHQQEDAHEFLMFTLETMHESCLQVHRQSKPTSEDSSPIHDIFGGWWRSQIKC
LLCQGTSDTYDRFLDIPLDISSAQSVKQALWDTEKSEELCGDNAYYCGKCRQKMPASKTL
HVHIAPKVLMVVLNRFSAFTGNKLDRKVSYPEFLDLKPYLSEPTGGPLPYALYAVLVHDG
ATSHSGHYFCCVKAGHGKWYKMDDTKVTRCDVTSVLNENAYVLFYVQQANLKQVSIDMPE
GRINEVLDPEYQLKKSRRKKHKKKSPFTEDLGEPCENRDKRAIKETSLGKGKVLQEVNHK
KAGQKHGNTKLMPQKQNHQKAGQNLRNTEVELDLPADAIVIHQPRSTANWGRDSPDKENQ
PLHNADRLLTSQGPVNTWQLCRQEGRRRSKKGQNKNKQGQRLLLVC
NT seq 1581 nt NT seq  +upstreamnt  +downstreamnt
atggtggttgctctttccttcccagaagcagatccagccctatcatctcctgatgcccca
gagctgcatcaggatgaagctcaggtggtggaggagctaactgtcaatggaaagcacagt
ctgagttgggagagtccccaaggaccaggatgcgggctccagaacacaggcaacagctgc
tacctgaatgcagccctgcagtgcttgacacacacaccacctctagctgactacatgctg
tcccaggagcacagtcaaacctgttgttccccagaaggctgtaagttgtgtgctatggaa
gcccttgtgacccagagtctcctgcactctcactcgggggatgtcatgaagccctcccat
attttgacctctgccttccacaagcaccagcaggaagatgcccacgagtttctcatgttc
accttggaaacaatgcatgaatcctgccttcaagtgcacagacaatcaaaacccacctct
gaggacagctcacccattcatgacatatttggaggctggtggaggtctcagatcaagtgt
ctcctttgccagggtacctcagatacctatgatcgcttcctggacatccccctggatatc
agctcagctcagagtgtaaagcaagccttgtgggatacagagaagtcagaagagctatgt
ggagataatgcctactactgtggtaagtgtagacagaagatgccagcttctaagaccctg
catgttcatattgctccaaaggtactcatggtagtgttaaatcgcttctcagccttcacg
ggtaacaagttagacagaaaagtaagttacccggagttccttgacctgaagccatacctg
tctgagcctactggaggacctttgccttatgccctctatgccgtcctggtccatgatggt
gcgacttctcacagtggacattacttctgttgtgtcaaagctggtcatgggaagtggtac
aagatggatgatactaaagtcaccaggtgtgatgtgacttctgtcctgaatgagaatgcc
tatgtgctcttctatgtgcagcaggccaacctcaaacaggtcagtattgacatgccagag
ggaagaataaatgaggttcttgaccctgaataccagctgaagaaatcacggagaaaaaag
cataagaagaaaagccctttcacagaagatttaggagagccctgcgaaaacagggataag
agagcaattaaagaaacctccttaggaaaggggaaagtgcttcaggaagtgaaccacaag
aaagctgggcagaaacacgggaataccaaactcatgcctcagaaacagaaccaccagaaa
gctgggcagaacctcaggaatactgaagttgaacttgatctgcctgctgatgcaattgtg
attcaccagcccagatccactgcaaactggggcagggattctccagacaaggagaatcaa
cccttgcacaatgctgacaggctcctcacctctcagggccctgtgaacacttggcagctc
tgtagacaggaagggagacgaagatcgaagaaggggcagaacaagaacaagcaagggcag
aggcttctgcttgtttgctag

DBGET integrated database retrieval system