KEGG   Mus musculus (mouse): 13532Help
Entry
13532             CDS       T01002                                 

Gene name
Usp17lc, Dub-2, Dub2, Dub2b, Usp17l5
Definition
ubiquitin specific peptidase 17-like C
Orthology
K11845  
ubiquitin carboxyl-terminal hydrolase 17 [EC:3.1.2.15]
Organism
mmu  Mus musculus (mouse)
Brite
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     13532 (Usp17lc)
Peptidases [BR:mmu01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   13532 (Usp17lc)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
UniProt: 
Position
7 E3; 7 54.85 cM
AA seq 545 aa AA seqDB search
MVVSLSFPEADPALSSPGAQQLHQDEAQVVVELTANDKPSLSWECPQGPGCGLQNTGNSC
YLNAALQCLTHTPPLADYMLSQEYSQTCCSPEGCKMCAMEAHVTQSLLHSHSGDVMKPSQ
ILTSAFHKHQQEDAHEFLMFTLETMHESCLQVHRQSEPTSEDSSPIHDIFGGLWRSQIKC
LHCQGTSDTYDRFLDVPLDISSAQSVNQALWDTEKSEELRGENAYYCGRCRQKMPASKTL
HIHSAPKVLLLVLKRFSAFMGNKLDRKVSYPEFLDLKPYLSQPTGGPLPYALYAVLVHEG
ATCHSGHYFSYVKARHGAWYKMDDTKVTSCDVTSVLNENAYVLFYVQQTDLKQVSIDMPE
GRVHEVLDPEYQLKKSRRKKHKKKSPCTEDAGEPCKNREKRATKETSLGEGKVLQEKNHK
KAGQKHENTKLVPQEQNHQKLGQKHRINEILPQEQNHQKAGQSLRNTEGELDLPADAIVI
HLLRSTENWGRDAPDKENQPWHNADRLLTSQDPVNTGQLCRQEGRRRSKKGKNKNKQGQR
LLLVC
NT seq 1638 nt NT seq  +upstreamnt  +downstreamnt
atggtggtttctctttccttcccagaagcagatccagccctatcatctcctggtgcccaa
cagctgcatcaggatgaagctcaggtagtggtggagctaactgccaatgacaagcccagt
ctgagttgggaatgtccccaaggaccaggatgcgggcttcagaacacaggcaacagctgc
tacctgaatgcagccctgcagtgcttgacacacacaccacctctagctgactacatgctg
tcccaggagtacagtcaaacctgttgttccccagaaggctgtaagatgtgtgctatggaa
gcccatgtaacccagagtctcctgcactctcactcgggggatgtcatgaagccctcccag
attttgacctctgccttccacaagcaccagcaggaagatgcccatgagtttctcatgttc
accttggaaacaatgcatgaatcctgccttcaagtgcacagacaatcagaacccacctct
gaggacagctcacccattcatgacatatttggaggcttgtggaggtctcagatcaagtgt
ctccattgccagggtacctcagatacatatgatcgcttcctggatgtccccctggatatc
agctcagctcagagtgtaaatcaagccttgtgggatacagagaagtcagaagagctacgt
ggagagaatgcctactactgtggtaggtgtagacagaagatgccagcttccaagaccctg
catattcatagtgccccaaaggtactcctgctagtgttaaagcgcttctcggccttcatg
ggtaacaagttggacagaaaagtaagctacccagagttccttgacctgaagccatacctg
tcccagcctactggaggacctttgccttatgccctctatgctgtcctggtccatgaaggt
gcgacttgtcacagtggacattacttctcttatgtcaaagccagacatggggcatggtac
aagatggatgatactaaggtcaccagctgcgatgtgacttctgtcctgaatgagaatgcc
tatgtgctcttctatgtgcagcagactgacctcaaacaggtcagtattgacatgccagag
ggcagagtacatgaggttctcgaccctgaataccagctgaagaaatcccggagaaaaaag
cataagaagaaaagcccttgcacagaagatgcgggagagccctgcaaaaacagggagaag
agagcaaccaaagaaacctccttaggggaggggaaagtgcttcaggaaaagaaccacaag
aaagctgggcagaaacatgagaataccaaacttgtgcctcaggaacagaaccaccagaaa
cttgggcagaaacacaggatcaatgaaatcttgcctcaggaacagaaccaccagaaagct
gggcagagcctcaggaacacggaaggtgaacttgatctgcctgctgatgcaattgtgatt
cacctgctcagatccacagaaaactggggcagggatgctccagacaaggagaatcaaccc
tggcacaatgctgacaggctcctcacctctcaggaccctgtgaacactgggcagctctgt
agacaggaaggaagacgaagatcaaagaaggggaagaacaagaacaagcaagggcagagg
cttctgcttgtttgctag

DBGET integrated database retrieval system