KEGG   Mus musculus (mouse): 13548Help
Entry
13548             CDS       T01002                                 

Gene name
Dyrk1a, 2310043O08Rik, D16Ertd272e, D16Ertd493e, Dyrk, Gm10783, Mnbh, Mp86, mmb
Definition
dual-specificity tyrosine-(Y)-phosphorylation regulated kinase 1a (EC:2.7.12.1)
Orthology
K08825  
dual-specificity tyrosine-(Y)-phosphorylation regulated kinase [EC:2.7.12.1]
Organism
mmu  Mus musculus (mouse)
Brite
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.1  dual-specificity kinase
     13548 (Dyrk1a)
Protein kinases [BR:mmu01001]
 Serine/threonine protein kinases: CMGC group
  DYRK family [OT]
   13548 (Dyrk1a)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
16 C4; 16 55.3 cM
AA seq 763 aa AA seqDB search
MHTGGETSACKPSSVRLAPSFSFHAAGLQMAAQMPHSHQYSDRRQPSISDQQVSALPYSD
QIQQPLTNQVMPDIVMLQRRMPQTFRDPATAPLRKLSVDLIKTYKHINEVYYAKKKRRHQ
QGQGDDSSHKKERKVYNDGYDDDNYDYIVKNGEKWMDRYEIDSLIGKGSFGQVVKAYDRV
EQEWVAIKIIKNKKAFLNQAQIEVRLLELMNKHDTEMKYYIVHLKRHFMFRNHLCLVFEM
LSYNLYDLLRNTNFRGVSLNLTRKFAQQMCTALLFLATPELSIIHCDLKPENILLCNPKR
SAIKIVDFGSSCQLGQRIYQYIQSRFYRSPEVLLGMPYDLAIDMWSLGCILVEMHTGEPL
FSGANEVDQMNKIVEVLGIPPAHILDQAPKARKFFEKLPDGTWSLKKTKDGKREYKPPGT
RKLHNILGVETGGPGGRRAGESGHTVADYLKFKDLILRMLDYDPKTRIQPYYALQHSFFK
KTADEGTNTSNSVSTSPAMEQSQSSGTTSSTSSSSGGSSGTSNSGRARSDPTHQHRHSGG
HFAAAVQAMDCETHSPQVRQQFPAPLGWSGTEAPTQVTVETHPVQETTFHVAPQQNALHH
HHGNSSHHHHHHHHHHHHHGQQALGNRTRPRVYNSPTNSSSTQDSMEVGHSHHSMTSLSS
STTSSSTSSSSTGNQGNQAYQNRPVAANTLDFGQNGAMDVNLTVYSNPRQETGIAGHPTY
QFSANTGPAHYMTEGHLAMRQGADREESPMTGVCVQQSPVASS
NT seq 2292 nt NT seq  +upstreamnt  +downstreamnt
atgcatacaggaggagagacttcagcatgcaaaccttcatctgtccggcttgcaccgtcg
ttctcattccatgctgctggccttcagatggctgcacagatgccccactcacaccagtac
agtgaccgtcgccagccgagcataagtgaccagcaggtgtctgccttaccatattctgac
cagattcagcaacctctaactaaccaggtgatgcctgacattgtcatgttacagaggcgg
atgccccaaaccttccgtgatccagcaactgctcctctgagaaaactctctgtggacttg
atcaaaacatacaagcatattaatgaggtttactatgcaaaaaagaagcgaagacaccaa
cagggccagggggacgattccagtcataagaaggagcggaaggtttacaatgatggttac
gatgatgataactatgattatattgtaaaaaacggggaaaagtggatggatcggtatgaa
atcgactccttaataggcaaaggttcatttggacaggttgtgaaagcttatgacagagtg
gagcaagaatgggtcgccattaaaatcatcaagaacaagaaagcgtttctgaatcaagcc
cagatagaagtgcggctgcttgagctcatgaacaaacacgacactgaaatgaagtactac
atagtgcatttgaaacgccactttatgtttcgaaaccatctctgtttagtgtttgaaatg
ctgtcctataatctctatgatttgttgagaaacaccaacttccgaggggtctctttgaac
ctaacacgaaagtttgcgcaacagatgtgcacagcattgctttttcttgcgactccagaa
cttagtatcattcactgtgacttaaagcctgagaacatccttctgtgtaaccccaaacgg
agtgcaatcaagattgttgattttggcagctcttgtcagttggggcagaggatataccag
tatattcagagtcgcttttatcggtctccagaggtgctactgggaatgccttatgacctt
gctatcgacatgtggtcccttggatgtatcttggttgaaatgcacactggagagcctctg
ttcagtggtgccaatgaggtcgatcagatgaataaaatagtggaagtcttgggcatccca
cctgctcatattcttgaccaagcaccgaaagcaagaaagttctttgagaagttgcccgat
ggcacttggagcttaaagaagaccaaagatggaaaacgggagtacaaaccaccaggaacc
cgtaaacttcataatattcttggagtagaaacaggaggacctggcgggcggcgtgctggg
gaatcgggtcatactgtagctgactacttgaagttcaaagacctcattttaaggatgctt
gattatgaccccaaaactcggattcaaccttattatgccctgcagcacagttttttcaag
aaaacagctgatgaaggtaccaacacaagtaacagtgtgtctaccagccctgcgatggag
cagtctcagtcttcaggcaccacctccagcacctcctccagctcaggtggatcctcggga
acgagtaacagtgggagagccaggtcggatccgacgcaccagcatcgacacagcggtgga
cacttcgctgctgctgtccaggccatggactgtgagacacacagtccccaggtgcgccag
cagtttccggctcctctgggatggtcaggcactgaagctcctacacaagtcactgttgaa
actcatcctgttcaagagacaacctttcatgtagccccccagcagaacgcattgcatcat
caccatggaaacagttcccatcaccaccaccaccaccatcaccaccaccaccaccatgga
cagcaagccttgggtaaccggaccaggccaagggtctacaattctccaacaaatagctcc
tctacccaggattctatggaggttggccacagtcaccactccatgacatccctgtcttcc
tcaacaacttcttcctcgacatcttcctcctctactggtaatcaaggcaatcaggcctat
cagaaccgcccagtggctgctaacaccttggactttggacagaatggagctatggacgtt
aatttgaccgtctactccaatccccgccaagagactggcatagctggacatccaacatac
caattttctgctaatacaggtcctgcacattacatgactgaaggacatctggcgatgaga
caaggggctgatagagaagagtctcccatgacaggagtttgtgtgcaacagagtcctgta
gctagctcgtga

DBGET integrated database retrieval system