KEGG   Mus musculus (mouse): 13549Help
Entry
13549             CDS       T01002                                 

Gene name
Dyrk1b, Mirk
Definition
(RefSeq) dual-specificity tyrosine-(Y)-phosphorylation regulated kinase 1b
  KO
K08825  dual specificity tyrosine-phosphorylation-regulated kinase 1 [EC:2.7.12.1]
Organism
mmu  Mus musculus (mouse)
Brite
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.1  dual-specificity kinase
     13549 (Dyrk1b)
Protein kinases [BR:mmu01001]
 Serine/threonine kinases: CMGC group
  DYRK family [OT]
   13549 (Dyrk1b)
Membrane trafficking [BR:mmu04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Kinases
    13549 (Dyrk1b)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr APH Choline_kinase
Motif
Other DBs
NCBI-GeneID: 13549
NCBI-ProteinID: NP_001033046
MGI: 1330302
Ensembl: ENSMUSG00000002409
Vega: OTTMUSG00000037983
UniProt: Q9Z188
Position
7; 7 A3
AA seq 629 aa AA seqDB search
MAVPPGHGPFSGFPGPQEHTQVLPDVRLLPRRLPLAFRDAASAPLRKLSVDLIKTYKHIN
EVYYAKKKRRAQQAPPQDSSTKKEKKVLNHGYDDDNHDYIVRSGERWLERYEIDSLIGKG
SFGQVVKAYDHQTQELVAIKIIKNKKAFLNQAQIELRLLELMNQHDTEMKYYIVHLKRHF
MFRNHLCLVFELLSYNLYDLLRNTHFRGVSLNLTRKLAQQLCTALLFLATPELSIIHCDL
KPENILLCNPKRSAIKIVDFGSSCQLGQRIYQYIQSRFYRSPEVLLGTPYDLAIDMWSLG
CILVEMHTGEPLFSGSNEVDQMSRIVEVLGIPPAPMLEQAPKARKYFERLPGGGWTLRRT
KELRKDYQGPGTRRLQEVLGVQTGGPGGRRAGEPGHSPADYLRFQDLVLRMLEYEPAARI
SPLGALQHGFFRRTADEATNTGPAGSSASTSPAPLDTCPSSSTASSISSSGGSSGSSNDN
RAYRYSNRYCGGPGPPITDCEMNSPQVLPSQPLRPWAGGDVPHKTHQAPISASTLPGTGA
QLPPLPRCLGRPPSPTSPPPPELMDVSLVGSPPDCSPPPPAPAPQHPAASALRTRMTGGR
PPLPPPDDPATLGPRLGLHGVPQSTAASS
NT seq 1890 nt NT seq  +upstreamnt  +downstreamnt
atggccgtcccaccaggccatggtcctttctctggctttccggggccccaggaacacaca
caggtactacctgatgtgcggctcctgccccggagactgcccctggccttccgggatgcg
gcctcagccccgctgcgcaagctctcggtggacctcatcaagacctacaagcacatcaat
gaggtatactatgcgaagaagaagcggcgggcccaacaggcgccaccccaggactcgagc
accaaaaaggagaagaaggtcctgaaccacggttatgatgacgacaaccacgactacatt
gtgcgcagtggcgagcgctggctagagcgctatgagattgactctcttattggcaaaggc
tcctttggccaggtggtgaaagcctatgatcaccagactcaggagctggtggccatcaag
atcatcaagaacaaaaaggccttcctgaaccaggcacagattgagctacggctgttggag
ctgatgaaccagcatgatacagagatgaagtactacatagtacaccttaagcggcacttc
atgttccggaatcacctgtgcctggtgtttgagctgctgtcctacaacctgtacgacctc
ctccgcaacacacactttcggggtgtctcactgaacctgacgaggaagctggcacagcag
ctctgcacagctctgctctttctggccacccccgagctcagcatcatccactgcgacctc
aagcctgagaacatcctgctctgcaaccccaagcgcagtgccatcaagatcgtggacttc
ggcagttcctgccagcttggccagcggatctaccagtatatccagagccgcttctaccgc
tcacccgaggtgctcctgggtacaccctatgacctggccattgacatgtggtccctgggc
tgcatcctcgtggagatgcacaccggagagcccctcttcagtggctctaatgaggtggac
cagatgagccgtattgtggaggtgttgggcatccctcccgcacccatgctggaacaggca
cccaaggctcgaaagtactttgagcggctgcctgggggtggctggaccctacgaaggaca
aaggaactcaggaaggattaccagggccctgggacacggcggctgcaggaggtgctgggc
gtgcagacgggcgggcccgggggccggcgggcgggggagcccggccacagccccgccgac
tacctccgcttccaggacctggtgctgcgcatgctggaatatgagcccgccgcccgcatc
agccctctgggcgctctgcagcatggcttcttccgccgcacggccgacgaggccaccaac
acgggcccggcaggcagcagtgcctccacctcgccggcgccccttgacacctgcccctcc
tctagcaccgccagctccatctccagctctggaggttccagtggctcctccaacgacaac
agagcctaccgatacagcaaccgatattgtgggggcccagggccccccatcactgactgt
gagatgaacagcccccaggtcctaccctcccagcctctgcgcccctgggcagggggtgat
gtgccccacaagacacatcaagcccctatctctgcctcaacattgccggggactggggct
cagttacccccattgccccgttgccttggacgacccccatcaccaacatcaccaccaccc
ccagagttgatggatgtgagcctggtgggcagccctccagactgctctccacctcctcca
gcacctgccccccagcacccggctgcctcagccctccggactcggatgacaggaggtcga
ccacctctcccaccccctgatgaccctgccactctggggcctcgcctgggtctccatggt
gtaccccagagcacagcagccagctcatga

DBGET integrated database retrieval system