KEGG   Mus musculus (mouse): 13549Help
Entry
13549             CDS       T01002                                 

Gene name
Dyrk1b, Mirk
Definition
dual-specificity tyrosine-(Y)-phosphorylation regulated kinase 1b (EC:2.7.12.1)
Orthology
K08825  
dual-specificity tyrosine-(Y)-phosphorylation regulated kinase [EC:2.7.12.1]
Organism
mmu  Mus musculus (mouse)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
7 A3; 7
AA seq 629 aa AA seqDB search
MAVPPGHGPFSGFPGPQEHTQVLPDVRLLPRRLPLAFRDAASAPLRKLSVDLIKTYKHIN
EVYYAKKKRRAQQAPPQDSSTKKEKKVLNHGYDDDNHDYIVRSGERWLERYEIDSLIGKG
SFGQVVKAYDHQTQELVAIKIIKNKKAFLNQAQIELRLLELMNQHDTEMKYYIVHLKRHF
MFRNHLCLVFELLSYNLYDLLRNTHFRGVSLNLTRKLAQQLCTALLFLATPELSIIHCDL
KPENILLCNPKRSAIKIVDFGSSCQLGQRIYQYIQSRFYRSPEVLLGTPYDLAIDMWSLG
CILVEMHTGEPLFSGSNEVDQMSRIVEVLGIPPAPMLEQAPKARKYFERLPGGGWTLRRT
KELRKDYQGPGTRRLQEVLGVQTGGPGGRRAGEPGHSPADYLRFQDLVLRMLEYEPAARI
SPLGALQHGFFRRTADEATNTGPAGSSASTSPAPLDTCPSSSTASSISSSGGSSGSSNDN
RAYRYSNRYCGGPGPPITDCEMNSPQVLPSQPLRPWAGGDVPHKTHQAPISASTLPGTGA
QLPPLPRCLGRPPSPTSPPPPELMDVSLVGSPPDCSPPPPAPAPQHPAASALRTRMTGGR
PPLPPPDDPATLGPRLGLHGVPQSTAASS
NT seq 1890 nt NT seq  +upstreamnt  +downstreamnt
atggccgtcccaccaggccatggtcctttctctggctttccggggccccaggaacacaca
caggtactacctgatgtgcggctcctgccccggagactgcccctggccttccgggatgcg
gcctcagccccgctgcgcaagctctcggtggacctcatcaagacctacaagcacatcaat
gaggtatactatgcgaagaagaagcggcgggcccaacaggcgccaccccaggactcgagc
accaaaaaggagaagaaggtcctgaaccacggttatgatgacgacaaccacgactacatt
gtgcgcagtggcgagcgctggctagagcgctatgagattgactctcttattggcaaaggc
tcctttggccaggtggtgaaagcctatgatcaccagactcaggagctggtggccatcaag
atcatcaagaacaaaaaggccttcctgaaccaggcacagattgagctacggctgttggag
ctgatgaaccagcatgatacagagatgaagtactacatagtacaccttaagcggcacttc
atgttccggaatcacctgtgcctggtgtttgagctgctgtcctacaacctgtacgacctc
ctccgcaacacacactttcggggtgtctcactgaacctgacgaggaagctggcacagcag
ctctgcacagctctgctctttctggccacccccgagctcagcatcatccactgcgacctc
aagcctgagaacatcctgctctgcaaccccaagcgcagtgccatcaagatcgtggacttc
ggcagttcctgccagcttggccagcggatctaccagtatatccagagccgcttctaccgc
tcacccgaggtgctcctgggtacaccctatgacctggccattgacatgtggtccctgggc
tgcatcctcgtggagatgcacaccggagagcccctcttcagtggctctaatgaggtggac
cagatgagccgtattgtggaggtgttgggcatccctcccgcacccatgctggaacaggca
cccaaggctcgaaagtactttgagcggctgcctgggggtggctggaccctacgaaggaca
aaggaactcaggaaggattaccagggccctgggacacggcggctgcaggaggtgctgggc
gtgcagacgggcgggcccgggggccggcgggcgggggagcccggccacagccccgccgac
tacctccgcttccaggacctggtgctgcgcatgctggaatatgagcccgccgcccgcatc
agccctctgggcgctctgcagcatggcttcttccgccgcacggccgacgaggccaccaac
acgggcccggcaggcagcagtgcctccacctcgccggcgccccttgacacctgcccctcc
tctagcaccgccagctccatctccagctctggaggttccagtggctcctccaacgacaac
agagcctaccgatacagcaaccgatattgtgggggcccagggccccccatcactgactgt
gagatgaacagcccccaggtcctaccctcccagcctctgcgcccctgggcagggggtgat
gtgccccacaagacacatcaagcccctatctctgcctcaacattgccggggactggggct
cagttacccccattgccccgttgccttggacgacccccatcaccaacatcaccaccaccc
ccagagttgatggatgtgagcctggtgggcagccctccagactgctctccacctcctcca
gcacctgccccccagcacccggctgcctcagccctccggactcggatgacaggaggtcga
ccacctctcccaccccctgatgaccctgccactctggggcctcgcctgggtctccatggt
gtaccccagagcacagcagccagctcatga

DBGET integrated database retrieval system