KEGG   Mus musculus (mouse): 13549Help
Entry
13549             CDS       T01002                                 

Gene name
Dyrk1b, Mirk
Definition
dual-specificity tyrosine-(Y)-phosphorylation regulated kinase 1b (EC:2.7.12.1)
Orthology
K08825  
dual specificity tyrosine-phosphorylation-regulated kinase 1 [EC:2.7.12.1]
Organism
mmu  Mus musculus (mouse)
Brite
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.1  dual-specificity kinase
     13549 (Dyrk1b)
Protein kinases [BR:mmu01001]
 Serine/threonine protein kinases: CMGC group
  DYRK family [OT]
   13549 (Dyrk1b)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
7 A3; 7
AA seq 629 aa AA seqDB search
MAVPPGHGPFSGFPGPQEHTQVLPDVRLLPRRLPLAFRDAASAPLRKLSVDLIKTYKHIN
EVYYAKKKRRAQQAPPQDSSTKKEKKVLNHGYDDDNHDYIVRSGERWLERYEIDSLIGKG
SFGQVVKAYDHQTQELVAIKIIKNKKAFLNQAQIELRLLELMNQHDTEMKYYIVHLKRHF
MFRNHLCLVFELLSYNLYDLLRNTHFRGVSLNLTRKLAQQLCTALLFLATPELSIIHCDL
KPENILLCNPKRSAIKIVDFGSSCQLGQRIYQYIQSRFYRSPEVLLGTPYDLAIDMWSLG
CILVEMHTGEPLFSGSNEVDQMSRIVEVLGIPPAPMLEQAPKARKYFERLPGGGWTLRRT
KELRKDYQGPGTRRLQEVLGVQTGGPGGRRAGEPGHSPADYLRFQDLVLRMLEYEPAARI
SPLGALQHGFFRRTADEATNTGPAGSSASTSPAPLDTCPSSSTASSISSSGGSSGSSNDN
RAYRYSNRYCGGPGPPITDCEMNSPQVLPSQPLRPWAGGDVPHKTHQAPISASTLPGTGA
QLPPLPRCLGRPPSPTSPPPPELMDVSLVGSPPDCSPPPPAPAPQHPAASALRTRMTGGR
PPLPPPDDPATLGPRLGLHGVPQSTAASS
NT seq 1890 nt NT seq  +upstreamnt  +downstreamnt
atggccgtcccaccaggccatggtcctttctctggctttccggggccccaggaacacaca
caggtactacctgatgtgcggctcctgccccggagactgcccctggccttccgggatgcg
gcctcagccccgctgcgcaagctctcggtggacctcatcaagacctacaagcacatcaat
gaggtatactatgcgaagaagaagcggcgggcccaacaggcgccaccccaggactcgagc
accaaaaaggagaagaaggtcctgaaccacggttatgatgacgacaaccacgactacatt
gtgcgcagtggcgagcgctggctagagcgctatgagattgactctcttattggcaaaggc
tcctttggccaggtggtgaaagcctatgatcaccagactcaggagctggtggccatcaag
atcatcaagaacaaaaaggccttcctgaaccaggcacagattgagctacggctgttggag
ctgatgaaccagcatgatacagagatgaagtactacatagtacaccttaagcggcacttc
atgttccggaatcacctgtgcctggtgtttgagctgctgtcctacaacctgtacgacctc
ctccgcaacacacactttcggggtgtctcactgaacctgacgaggaagctggcacagcag
ctctgcacagctctgctctttctggccacccccgagctcagcatcatccactgcgacctc
aagcctgagaacatcctgctctgcaaccccaagcgcagtgccatcaagatcgtggacttc
ggcagttcctgccagcttggccagcggatctaccagtatatccagagccgcttctaccgc
tcacccgaggtgctcctgggtacaccctatgacctggccattgacatgtggtccctgggc
tgcatcctcgtggagatgcacaccggagagcccctcttcagtggctctaatgaggtggac
cagatgagccgtattgtggaggtgttgggcatccctcccgcacccatgctggaacaggca
cccaaggctcgaaagtactttgagcggctgcctgggggtggctggaccctacgaaggaca
aaggaactcaggaaggattaccagggccctgggacacggcggctgcaggaggtgctgggc
gtgcagacgggcgggcccgggggccggcgggcgggggagcccggccacagccccgccgac
tacctccgcttccaggacctggtgctgcgcatgctggaatatgagcccgccgcccgcatc
agccctctgggcgctctgcagcatggcttcttccgccgcacggccgacgaggccaccaac
acgggcccggcaggcagcagtgcctccacctcgccggcgccccttgacacctgcccctcc
tctagcaccgccagctccatctccagctctggaggttccagtggctcctccaacgacaac
agagcctaccgatacagcaaccgatattgtgggggcccagggccccccatcactgactgt
gagatgaacagcccccaggtcctaccctcccagcctctgcgcccctgggcagggggtgat
gtgccccacaagacacatcaagcccctatctctgcctcaacattgccggggactggggct
cagttacccccattgccccgttgccttggacgacccccatcaccaacatcaccaccaccc
ccagagttgatggatgtgagcctggtgggcagccctccagactgctctccacctcctcca
gcacctgccccccagcacccggctgcctcagccctccggactcggatgacaggaggtcga
ccacctctcccaccccctgatgaccctgccactctggggcctcgcctgggtctccatggt
gtaccccagagcacagcagccagctcatga

DBGET integrated database retrieval system