KEGG   Mus musculus (mouse): 13589Help
Entry
13589             CDS       T01002                                 

Gene name
Mapre1, 5530600P05Rik, AI462499, AI504412, AW260097, BIM1p, D2Ertd459e, Eb1
Definition
(RefSeq) microtubule-associated protein, RP/EB family, member 1
  KO
K10436  
microtubule-associated protein, RP/EB family
Organism
mmu  Mus musculus (mouse)
Brite
Chromosome [BR:mmu03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Microtubules
    Microtubule-associated proteins
     13589 (Mapre1)
Cytoskeleton proteins [BR:mmu04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    EB / APC
     13589 (Mapre1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
2 H1; 2 75.95 cM
AA seq 268 aa AA seqDB search
MAVNVYSTSVTSDNLSRHDMLAWINESLQLNLTKIEQLCSGAAYCQFMDMLFPGSIALKK
VKFQAKLEHEYIQNFKILQAGFKRMGVDKIIPVDKLVKGKFQDNFEFVQWFKKFFDANYD
GKEYDPVAARQGQETAVAPSLVAPALSKPKKPLGSSTAAPQRPIATQRTTAAPKAGPGMV
RKNPGVGNGDDEAAELMQQVKVLKLTVEDLEKERDFYFGKLRNIELICQENEGENDPVLQ
RIVDILYATDEGFVIPDEGGPQEEQEEY
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
atggcagtgaatgtgtactctacgtcagtcaccagtgataacctaagtcgacatgacatg
ctggcttggatcaatgaatctctgcagttgaatctgacaaagatagaacagttgtgttca
ggggctgcatattgtcagtttatggacatgctcttccctggatccattgccttgaagaaa
gtgaaattccaagctaagctagaacatgaatatatccagaacttcaaaatactacaagca
ggcttcaagaggatgggcgttgacaaaataattcctgtggataaattagtaaaaggaaaa
tttcaggacaattttgaatttgttcaatggttcaagaagttttttgatgcaaattatgat
ggaaaagagtatgatcctgtagctgccagacaaggtcaagaaactgcagtggctccttct
cttgtcgccccagctttgagtaaaccgaagaaacctctcggctccagtactgcagcccca
cagagacccattgcaacacagaggactactgcagctcctaaggctggccccggaatggtg
cgaaagaatcctggtgtgggcaatggagatgatgaagcagctgaattgatgcagcaggtc
aaagtactgaagcttactgttgaagacttggagaaggagagagacttctacttcggaaag
ctaaggaacattgaactgatttgccaggagaacgagggggaaaacgaccctgtactgcag
aggattgtagatattctttatgccacagatgaaggctttgtgatacctgatgaagggggc
ccacaggaggaacaagaagagtattaa

DBGET integrated database retrieval system