KEGG   Mus musculus (mouse): 13591Help
Entry
13591             CDS       T01002                                 

Gene name
Ebf1, Ebf, O/E-1, OE-1, Olf-1, Olf1
Definition
(RefSeq) early B cell factor 1
  KO
K09103  
early B-cell factor
Organism
mmu  Mus musculus (mouse)
Brite
Transcription factors [BR:mmu03000]
 Eukaryotic Type
  Basic helix-loop-helix (bHLH)
   HLH domain only
    13591 (Ebf1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
11 B1.1; 11 26.45 cM
AA seq 591 aa AA seqDB search
MFGIQESIQRSGSSMKEEPLGSGMNAVRTWMQGAGVLDANTAAQSGVGLARAHFEKQPPS
NLRKSNFFHFVLALYDRQGQPVEIERTAFVGFVEKEKEANSEKTNNGIHYRLQLLYSNGI
RTEQDFYVRLIDSMTKQAIVYEGQDKNPEMCRVLLTHEIMCSRCCDKKSCGNRNETPSDP
VIIDRFFLKFFLKCNQNCLKNAGNPRDMRRFQVVVSTTVNVDGHVLAVSDNMFVHNNSKH
GRRARRLDPSEGTPSYLEHATPCIKAISPSEGWTTGGATVIIIGDNFFDGLQVIFGTMLV
WSELITPHAIRVQTPPRHIPGVVEVTLSYKSKQFCKGTPGRFIYTALNEPTIDYGFQRLQ
KVIPRHPGDPERLPKEVILKRAADLVEALYGMPHNNQEIILKRAADIAEALYSVPRNHNQ
LPALANTSVHAGMMGVNSFSGQLAVNVSEASQATNQGFTRNSSSVSPHGYVPSTTPQQTN
YNSVTTSMNGYGSAAMSNLGGSPTFLNGSAANSPYAIVPSSPTMASSTSLPSNCSSSSGI
FSFSPANMVSAVKQKSAFAPVVRPQTSPPPTCTSTNGNSLQAISGMIVPPM
NT seq 1776 nt NT seq  +upstreamnt  +downstreamnt
atgtttgggatccaggaaagcatccaacggagtggaagcagtatgaaggaagagccgctg
ggcagcggcatgaacgcggtgcggacgtggatgcagggcgccggggtgctggacgccaac
acagcggcgcagagcggggtgggtctggcccgggctcactttgagaagcagccgccttct
aacctgcggaaatccaacttcttccacttcgtcctggccctctacgacagacagggccag
cccgtggagattgagaggacggcctttgtggggttcgtggagaaggaaaaagaagccaac
agcgaaaagaccaataatgggatccactaccggctccagctcctctacagcaatgggata
cggacagaacaggatttctatgtgcgcctcatcgactccatgacaaaacaagccatagtg
tatgaaggccaagacaagaaccctgaaatgtgccgagtattgctcacacacgagatcatg
tgcagccgctgttgtgacaagaaaagctgtggcaaccgaaatgagactccctcagatcca
gtgataattgacaggttcttcctgaagtttttccttaaatgcaaccaaaattgcctaaag
aatgcaggaaacccacgtgacatgcggagattccaggtcgtggtgtctaccacagtcaac
gtggatggccatgtcctggcagtctctgataacatgtttgtccacaataactccaagcac
gggcggagggctcggaggcttgacccctcggaaggtacgccctcttatctggaacatgct
actccctgtatcaaagccatcagcccgagtgaaggatggacgacgggaggcgcgactgtg
atcatcataggggacaatttctttgatgggttacaggtcatattcggtaccatgctggtc
tggagtgagttgataactcctcatgccatccgagttcagacacctcctcggcacatccct
ggtgtggtggaagtcacactgtcgtacaagtccaagcagttctgcaaagggacaccaggc
agattcatctacacagcactcaatgaacccaccatcgactacggcttccagaggttacag
aaggtcattcctcggcatcctggtgacccagagcgcttgccaaaggaagtgatccttaaa
agagctgcagatctggttgaagccctgtatgggatgccccacaacaaccaggagattatc
ctgaagagagctgccgacattgcagaggctctgtacagtgtccctcggaaccacaaccag
ctcccagcccttgctaacacttcggtccatgcagggatgatgggtgtgaactccttcagt
ggacaactggctgtgaatgtctcggaggcatcacaagccaccaatcaaggtttcacccgc
aactcaagcagcgtgtcaccacatggctatgtgccgagcaccaccccacagcaaaccaac
tataactcagtcaccacaagcatgaatggctacggctcagccgccatgtccaatttgggc
ggctccccaaccttcctcaatggctcagctgccaactcaccctatgccattgtgccatcc
agccccaccatggcctcatctacaagcctcccctccaactgcagtagctcctctggcatc
ttctccttctcaccagccaacatggtctcagcagtgaaacagaagagtgctttcgcacca
gttgtcagaccccagacgtcccctcctcccacctgcaccagcaccaacgggaacagcctg
caagcgatatctggcatgattgtccctcccatgtga

DBGET integrated database retrieval system