KEGG   Mus musculus (mouse): 13609Help
Entry
13609             CDS       T01002                                 

Gene name
S1pr1, AI849002, Edg1, Lpb1, S1p, S1p1
Definition
(RefSeq) sphingosine-1-phosphate receptor 1
  KO
K04288  
sphingosine 1-phosphate receptor 1
Organism
mmu  Mus musculus (mouse)
Pathway
FoxO signaling pathway
Sphingolipid signaling pathway
Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Environmental Information Processing
  Signal transduction
   04068 FoxO signaling pathway
    13609 (S1pr1)
   04071 Sphingolipid signaling pathway
    13609 (S1pr1)
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    13609 (S1pr1)
G protein-coupled receptors [BR:mmu04030]
 Class A. Rhodopsin family
  Lipid
   Sphingolipid [OT]
    13609 (S1pr1)
Cellular antigens [BR:mmu04090]
 Proteins
  13609 (S1pr1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
3; 3 G1
AA seq 382 aa AA seqDB search
MVSTSIPEVKALRSSVSDYGNYDIIVRHYNYTGKLNIGAEKDHGIKLTSVVFILICCFII
LENIFVLLTIWKTKKFHRPMYYFIGNLALSDLLAGVAYTANLLLSGATTYKLTPAQWFLR
EGSMFVALSASVFSLLAIAIERYITMLKMKLHNGSNSSRSFLLISACWVISLILGGLPIM
GWNCISSLSSCSTVLPLYHKHYILFCTTVFTLLLLSIVILYCRIYSLVRTRSRRLTFRKN
ISKASRSSEKSLALLKTVIIVLSVFIACWAPLFILLLLDVGCKAKTCDILYKAEYFLVLA
VLNSGTNPIIYTLTNKEMRRAFIRIVSCCKCPNGDSAGKFKRPIIPGMEFSRSKSDNSSH
PQKDDGDNPETIMSSGNVNSSS
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atggtgtccactagcatcccggaggttaaagctctccgcagctcagtctctgactatggg
aactatgatatcatagtccggcattacaactacacaggcaagttgaacatcggggcggag
aaggaccatggcattaaactgacttcagtggtgttcattctcatctgctgcttcatcatc
ctagagaatatatttgtcttgctaactatttggaaaaccaagaagttccaccggcccatg
tactatttcataggcaacctagccctctcggacctattagcaggcgtggcttacacagct
aacctgctgttgtctggggccaccacttacaagctcacacctgcccagtggtttctgcgg
gaagggagtatgtttgtggctctctctgcatcagtcttcagcctccttgccatcgccatt
gagcgctacatcaccatgctgaagatgaaactacacaacgggagcaacagctcgcgctcc
tttctgctgatcagcgcctgctgggtcatctccctcatcctggggggcctgcccatcatg
ggctggaactgcatcagctcgctgtctagctgctccaccgtgctcccgctctaccacaag
cactatattctcttctgcaccaccgtcttcactctgctcctgctttccatcgtcatcctc
tactgcaggatctactccttggtcaggactcgaagccgccgcctgaccttccgcaagaac
atctccaaggccagtcgcagttctgagaagtctctggccttgctgaagacggtgatcatt
gtcctgagtgtcttcattgcctgctgggcccctctcttcatcctactactgttagatgtg
ggctgcaaggcgaagacctgtgacatcctgtacaaagcagagtacttcctggttctggct
gtgctgaactcaggtaccaaccccatcatctacactctgaccaacaaggagatgcgccgg
gccttcatccggatcgtatcttgttgcaaatgccccaacggagactctgctggcaaattc
aagaggcccatcatcccaggcatggaatttagccgcagcaaatcagacaactcctctcac
ccccagaaggacgatggggacaacccagagaccattatgtcgtctggaaacgtcaattct
tcttcctaa

DBGET integrated database retrieval system