KEGG   Mus musculus (mouse): 13610Help
Entry
13610             CDS       T01002                                 

Gene name
S1pr3, AI132464, Edg3, Lpb3, S1p3
Definition
(RefSeq) sphingosine-1-phosphate receptor 3
  KO
K04290  
sphingosine 1-phosphate receptor 3
Organism
mmu  Mus musculus (mouse)
Pathway
Sphingolipid signaling pathway
Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Environmental Information Processing
  Signal transduction
   04071 Sphingolipid signaling pathway
    13610 (S1pr3)
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    13610 (S1pr3)
G protein-coupled receptors [BR:mmu04030]
 Class A. Rhodopsin family
  Lipid
   Sphingolipid [OT]
    13610 (S1pr3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
UniProt: 
Position
13; 13 B1
AA seq 378 aa AA seqDB search
MATTHAQGHQPVLGNDTLREHYDYVGKLAGRLRDPPEGGTLITTILFLVTCSFIVLENLM
VLIAIWKNNKFHNRMYFFIGNLALCDLLAGIAYKVNILMSGRKTFSLSPTVWFLREGSMF
VALGASTCSLLAIAIERHLTMIKMRPYDANKKHRVFLLIGMCWLIAFSLGALPILGWNCL
ENFPDCSTILPLYSKKYIAFLISIFTAILVTIVILYARIYCLVKSSSRRVANHNSERSMA
LLRTVVIVVSVFIACWSPLFILFLIDVACRAKECSILFKSQWFIMLAVLNSAMNPVIYTL
ASKEMRRAFFRLVCGCLVKGKGTQASPMQPALDPSRSKSSSSNNSSHSPKVKEDLPRVAT
SSCIIDKNRSFQNGVLCK
NT seq 1137 nt NT seq  +upstreamnt  +downstreamnt
atggcaaccacgcatgcgcagggccaccagccagtcttgggaaatgacactctccgggaa
cattacgattacgtggggaaactggcaggcaggctgcgggacccccctgagggtggcacc
ctcatcaccaccatcctcttcttggtcacctgtagcttcatcgtcttggagaacctgatg
gttttgattgccatctggaaaaacaataaatttcacaaccgcatgtactttttcatcggc
aacttggctctctgcgacctgctggccggcatagcatacaaggtcaatattcttatgtcc
ggcaggaagacgttcagtctgtctccaacagtgtggttcctcagggagggcagtatgttc
gtagccctgggcgcatccacctgcagcttactggccattgccattgagcgacacctgacc
atgatcaagatgaggccatatgatgccaacaagaagcaccgcgtgttccttctgattggg
atgtgctggctaattgccttctcgctgggtgccctgccaatcctgggctggaactgcctg
gagaactttcccgactgctctaccatcttgcccctctactccaagaaatacatcgccttc
ctcatcagtatcttcaccgccattctggtgaccatcgtcatcttgtatgcgcgcatctac
tgcctggtcaagtccagcagccgcagggtggccaaccacaactctgagagatccatggcc
cttctgcggaccgtagtgattgtggtgagtgtgttcattgcctgttggtccccacttttt
atcctcttcctcatcgacgtggcctgcagggcaaaggagtgctccatcctcttcaagagt
cagtggttcatcatgctggctgtcctcaactcggccatgaaccctgtcatctacacgctg
gccagcaaagagatgaggcgcgccttcttccggttggtgtgcggctgtctagtcaagggc
aaggggacccaggcctcacccatgcagcctgccctcgacccaagcagaagtaagtcaagc
tccagtaacaacagcagccactctccgaaggtcaaggaagacctgccccgcgtggctact
tcttcctgcatcattgacaaaaacaggtcgtttcagaacggggtcctctgcaagtga

DBGET integrated database retrieval system