KEGG   Mus musculus (mouse): 13629Help
Entry
13629             CDS       T01002                                 

Gene name
Eef2, Ef-2
Definition
(RefSeq) eukaryotic translation elongation factor 2
  KO
K03234  
elongation factor 2
Organism
mmu  Mus musculus (mouse)
Pathway
AMPK signaling pathway
Oxytocin signaling pathway
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Environmental Information Processing
  Signal transduction
   04152 AMPK signaling pathway
    13629 (Eef2)
 Organismal Systems
  Endocrine system
   04921 Oxytocin signaling pathway
    13629 (Eef2)
Translation factors [BR:mmu03012]
 Eukaryotic Type
  Elongation factors
   13629 (Eef2)
Exosome [BR:mmu04147]
 Exosomal proteins
  Proteins found in most exosomes
   13629 (Eef2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
UniProt: 
Position
10; 10 C1
AA seq 858 aa AA seqDB search
MVNFTVDQIRAIMDKKANIRNMSVIAHVDHGKSTLTDSLVCKAGIIASARAGETRFTDTR
KDEQERCITIKSTAISLFYELSENDLNFIKQSKDGSGFLINLIDSPGHVDFSSEVTAALR
VTDGALVVVDCVSGVCVQTETVLRQAIAERIKPVLMMNKMDRALLELQLEPEELYQTFQR
IVENVNVIISTYGEGESGPMGNIMIDPVLGTVGFGSGLHGWAFTLKQFAEMYVAKFAAKG
EGQLSAAERAKKVEDMMKKLWGDRYFDPANGKFSKSANSPDGKKLPRTFCQLILDPIFKV
FDAIMNFRKEETAKLIEKLDIKLDSEDKDKEGKPLLKAVMRRWLPAGDALLQMITIHLPS
PVTAQKYRCELLYEGPPDDEAAMGIKSCDPKGPLMMYISKMVPTSDKGRFYAFGRVFSGV
VSTGLKVRIMGPNYTPGKKEDLYLKPIQRTILMMGRYVEPIEDVPCGNIVGLVGVDQFLV
KTGTITTFEHAHNMRVMKFSVSPVVRVAVEAKNPADLPKLVEGLKRLAKSDPMVQCIIEE
SGEHIIAGAGELHLEICLKDLEEDHACIPIKKSDPVVSYRETVSEESNVLCLSKSPNKHN
RLYMKARPFPDGLAEDIDKGEVSARQELKARARYLAEKYEWDVAEARKIWCFGPDGTGPN
ILTDITKGVQYLNEIKDSVVAGFQWATKEGALCEENMRGVRFDVHDVTLHADAIHRGGGQ
IIPTARRCLYASVLTAQPRLMEPIYLVEIQCPEQVVGGIYGVLNRKRGHVFEESQVAGTP
MFVVKAYLPVNESFGFTADLRSNTGGQAFPQCVFDHWQILPGDPFDNSSRPSQVVAETRK
RKGLKEGIPALDNFLDKL
NT seq 2577 nt NT seq  +upstreamnt  +downstreamnt
atggtgaacttcacagtagatcagatccgtgccatcatggacaagaaagccaacatccgg
aacatgtcagtcatcgcccatgtggaccacggcaagtccacgctgaccgactcccttgtg
tgcaaggctggcatcattgcctctgcccgagctggggagacgcgcttcactgacactcgc
aaggatgagcaggagcgctgcatcacaatcaaatccaccgccatctccctcttctacgag
ctctctgagaacgacctgaacttcattaagcagagcaaggatggctcgggcttcctcatc
aacctcatcgactctccaggccatgtggacttctcttcagaggtgacagctgccttgcgt
gtcaccgatggagctctggtggtggtggactgtgtgtctggcgtgtgtgtgcagacagaa
actgtgctgcgccaggccatcgctgaacgcatcaagcccgtcctgatgatgaacaagatg
gaccgggccctgctggagctgcagctggagcccgaggagctctaccagaccttccagcgc
atcgtggagaacgtcaacgtcatcatctctacctacggcgagggcgagagtgggcccatg
ggcaatatcatgattgaccccgtcctgggcaccgtaggctttggttctggcctgcatggc
tgggccttcaccctgaagcagtttgcggagatgtatgtggccaagtttgcagccaagggt
gagggccagctgagcgcagccgagcgtgccaagaaagtagaggacatgatgaagaagctg
tggggagaccggtactttgatccggccaatggcaagttcagtaagtcagccaatagccca
gatgggaaaaaacttccccgcaccttctgccagctcatcctggaccccatcttcaaggtg
ttcgacgccatcatgaacttcaggaaggaggagacagccaagctgatcgagaagctggac
atcaagctggacagcgaggacaaagacaaggagggcaagccattgctcaaggctgtgatg
cgccgctggctgcctgcaggggacgccctcctgcagatgatcaccatccacttaccatcc
cccgtcactgcacagaagtaccgttgtgagctgctatacgaggggcctcccgacgatgag
gccgccatgggtattaagagctgcgaccccaaaggcccacttatgatgtacatttccaag
atggtgccaacctctgacaaaggccgcttctatgcctttggtagagtgttctctggggtg
gtgtccacgggcctgaaggtccggatcatgggccccaactacacgcctgggaagaaagag
gacctatacctgaagcctatccagagaaccattctgatgatgggccgctacgtggagccg
attgaggacgtgccatgtggaaacattgtggggctggtcggagtggaccagttccttgtg
aagacggggaccatcactacctttgagcacgctcacaacatgcgcgtgatgaagttcagc
gtcagccctgtcgtccgtgtggcagtggaggccaagaacccagctgacctgcccaagctg
gtggaggggctgaagcggctggctaagtctgaccctatggtgcagtgcatcattgaggag
tctggagaacatattattgctggcgccggtgagctgcacctggagatctgccttaaggac
ctggaggaggaccatgcctgcatccccatcaagaaatctgaccctgttgtgtcatatcgg
gagacagtcagtgaggaatccaacgtgctgtgtctgtccaagtcccccaataagcacaac
cggctgtacatgaaggccaggcccttccctgatggcctggcagaggacatcgataagggt
gaggtgtctgcccgccaggagctcaaggcacgtgcccgctacctggccgaaaagtatgag
tgggacgttgctgaagcccgcaagatctggtgctttggccctgatggcactggccccaac
attctcaccgacatcaccaagggtgtgcagtacctgaatgagatcaaggacagtgtggtg
gctggcttccagtgggctactaaggagggcgctctctgtgaggaaaacatgcgtggtgtg
cggtttgatgttcatgatgtgaccctgcatgctgatgccattcaccggggaggtggccag
atcatccccacagcacgccgctgcctgtatgccagtgtgctgaccgcacagccccgcctc
atggagcctatctatctggtggagatccagtgtcctgagcaagtggtgggtggcatctac
ggtgtcctgaacaggaagcgtggccatgtgtttgaggagtcccaggtggctggtaccccc
atgtttgtggtcaaggcatacctgcctgtcaatgagtcctttggcttcaccgctgatctg
cgatccaacaccggcggccaggccttcccccagtgcgtgtttgaccactggcagatcctg
cctggggatccttttgacaacagcagccgccccagccaagtggtagctgagacgcgcaag
cgcaagggcctgaaagagggcatcccagcgctggacaacttcctggacaaactgtag

DBGET integrated database retrieval system