KEGG   Mus musculus (mouse): 13631Help
Entry
13631             CDS       T01002                                 

Gene name
Eef2k, C86191, eEF-2K
Definition
eukaryotic elongation factor-2 kinase (EC:2.7.11.20)
Orthology
K08292  
elongation factor 2 kinase [EC:2.7.11.20]
Organism
mmu  Mus musculus (mouse)
Pathway
AMPK signaling pathway
Oxytocin signaling pathway
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Environmental Information Processing
  Signal transduction
   04152 AMPK signaling pathway
    13631 (Eef2k)
 Organismal Systems
  Endocrine system
   04921 Oxytocin signaling pathway
    13631 (Eef2k)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.20  elongation factor 2 kinase
     13631 (Eef2k)
Protein kinases [BR:mmu01001]
 Serine/threonine protein kinases: Atypical group
  Alpha family [OT]
   13631 (Eef2k)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
7; 7 F3
AA seq 724 aa AA seqDB search
MADEDLIFCLEGVDGGRCSRAGHNADSDTDSDDDEGYFICPITDDHMSNQNVSSKVQSYY
SNLTKTECGSTGSPASSFHFKEAWKHAIEKAKHMPDPWAEFHLEDIATEHATRHRYNAVT
GEWLKDEVLIKMASQPFGRGAMRECFRTKKLSNFLHAQQWKGASNYVAKRYIEPVDRSVY
FEDVQLQMEAKLWGEDYNRHKPPKQVDIMQMCIIELKDRPGQPLFHLEHYIEGKYIKYNS
NSGFVRDDNIRLTPQAFSHFTFERSGHQLIVVDIQGVGDLYTDPQIHTEKGTDFGDGNLG
VRGMALFFYSHACNRICQSMGLTPFDLSPREQDAVNQSTRLLQSAKTILRGTEEKCGSPR
IRTLSSSRPPLLLRLSENSGDENMSDVTFDSLPSSPSSATPHSQKLDHLHWPVFGDLDNM
GPRDHDRMDNHRDSENSGDSGYPSEKRSDLDDPEPREHGHSNGNRRHESDEDSLGSSGRV
CVETWNLLNPSRLHLPRPSAVALEVQRLNALDLGRKIGKSVLGKVHLAMVRYHEGGRFCE
KDEEWDRESAIFHLEHAADLGELEAIVGLGLMYSQLPHHILADVSLKETEENKTKGFDYL
LKAAEAGDRHSMILVARAFDTGLNLSPDRCQDWSEALHWYNTALETTDCDEGGEYDGIQD
EPQYALLAREAEMLLTGGFGLDKNPQRSGDLYTQAAEAAMEAMKGRLANQYYEKAEEAWA
QMEE
NT seq 2175 nt NT seq  +upstreamnt  +downstreamnt
atggcagacgaagacctcatcttctgcctggaaggtgttgacggtggcaggtgctcccga
gctggccacaatgcggactctgacacagacagtgacgatgatgagggctatttcatctgc
cccatcactgatgaccacatgtccaatcagaatgtcagctccaaagtccagagctactat
agcaacctaacaaaaacagagtgcggctccacagggtcaccagccagctccttccacttc
aaggaagcctggaagcatgcgatcgagaaagccaagcacatgcctgacccctgggctgaa
ttccatctcgaggacatcgccacagaacatgctactcggcacaggtacaacgctgtcacc
ggggaatggctgaaagacgaggttctgatcaagatggcgtctcagcccttcggccgtgga
gcaatgagggagtgcttcaggacgaagaaactctccaacttcttgcacgcccagcaatgg
aagggggcctccaactacgtggccaagcgctacatcgagccggtggacaggagcgtgtac
tttgaggatgtgcagctccagatggaggcgaagctctggggggaggattacaatcggcac
aagccccccaagcaggtggatatcatgcagatgtgcatcattgagctaaaggacagacca
ggccagcccctcttccacttggagcactacattgagggcaagtacatcaagtacaattcc
aactcaggctttgtccgtgatgacaacatccgactaaccccacaggccttcagccatttc
acatttgagcgttctggtcatcagctgattgtagtggacatccagggtgtgggtgacctt
tataccgacccacagatccacactgagaaaggcactgactttggagatggtaaccttggt
gtccggggaatggctctcttcttctactctcatgcctgcaaccggatttgtcagagcatg
ggccttacgccctttgacctctccccacgggaacaggatgcggtgaatcagagcaccagg
ctattgcaatcagccaagaccatcttgagggggacagaggagaagtgtgggagtccccgc
ataaggacactctctagcagccggccccctttgctccttcgcctgtcagagaactccggg
gatgagaacatgagtgacgtgacctttgactctctgccttcctccccgtcttcagctaca
ccacacagccagaaactggaccacctccattggccagtgtttggtgacctcgataacatg
ggccctagagaccatgaccgcatggacaatcaccgggactctgagaatagtggggacagt
gggtatccaagcgagaagcgaagtgacctggatgatcctgagccccgagaacacggccac
tccaacggcaaccgaaggcatgaatctgacgaggatagcctgggcagctctggacgggtc
tgtgtggagacgtggaacctgctcaatccctcccgcctgcacctgccgaggccctcggcc
gtggccctagaagtgcagaggctaaatgccctggaccttggaaggaaaatcgggaagtct
gttttggggaaggtccatttggccatggtgcgataccacgagggcgggcgcttctgcgag
aaggatgaggagtgggatcgagagtcagccatcttccatctggagcatgcagctgacctg
ggagaactggaggccatcgtgggcctaggcctcatgtactctcagctgccccaccacatc
ctggctgatgtctctctgaaggagacagaggagaacaagacaaaaggctttgattactta
ctgaaggcggcagaagctggtgacaggcattccatgattttagtggcccgagcttttgac
actggcctgaacctcagcccagacaggtgtcaagactggtcggaagccttgcactggtac
aacacagccctggagacaacagactgcgatgaaggcggggagtacgatgggatacaggac
gagccccagtacgcactgctggccagggaggcggagatgctgctcaccgggggatttgga
ctggacaagaacccccaaagatcaggagatttgtacacccaggcagctgaggcagcaatg
gaagccatgaagggccggctagccaaccagtactacgagaaggcggaagaggcctgggcc
cagatggaggaataa

DBGET integrated database retrieval system