KEGG   Mus musculus (mouse): 13639Help
Entry
13639             CDS       T01002                                 

Gene name
Efna4, EFL-4, Epl4, LERK-4
Definition
ephrin A4
Orthology
K05462  
ephrin-A
Organism
mmu  Mus musculus (mouse)
Pathway
Ras signaling pathway
Rap1 signaling pathway
PI3K-Akt signaling pathway
Axon guidance
Class
Environmental Information Processing; Signal transduction; Ras signaling pathway [PATH:mmu04014]
Environmental Information Processing; Signal transduction; Rap1 signaling pathway [PATH:mmu04015]
Environmental Information Processing; Signal transduction; PI3K-Akt signaling pathway [PATH:mmu04151]
Organismal Systems; Development; Axon guidance [PATH:mmu04360]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
3 F1; 3 39.07 cM
AA seq 206 aa AA seqDB search
MRLLPLLRTVLWAALLGSRLPGCSSLRHPIYWNSSNPRLLRGDAVVELGFNDYLDIFCPH
YESPGPPEGPETFALYMVDWSGYEACTAEGANAFQRWNCSMPFAPFSPVRFSEKIQRYTP
FPLGFEFLPGETYYYISVPTPESPGRCLRLQVSVCCKESGSSHESAHPVGSPGESGTSGW
RGGHAPSPLCLLLLLLLPILRLLRVL
NT seq 621 nt NT seq  +upstreamnt  +downstreamnt
atgcggctgctgcccctgctgcggactgtgctctgggccgcgctgctcggctcgcgcctg
ccggggtgctccagcctccgccacccaatctactggaactcctctaaccccaggttgctc
cgaggagatgccgtggtggagctgggcttcaacgattacctagacatcttctgcccacat
tatgaaagcccagggcccccagaaggcccggaaacctttgcattatacatggtggactgg
tcaggctacgaggcctgcacggcagagggggcaaatgccttccagcgctggaattgctcg
atgccttttgcccctttcagccctgttcgattctcagaaaagattcagcgctacacaccc
ttcccgctgggctttgagttcttgcctggagagacttactactacatctcggtgccgact
ccggagagtcctggccggtgcctgagactccaggtgtctgtctgctgcaaggagagcggg
tcatcacatgagtcagctcatcctgttgggagtcctggagaaagcggtacgtccgggtgg
cggggaggacacgcgcccagccccctgtgtctcttgctgctgctgctgctcccaatcctc
cgtctcctgagagttctgtga

DBGET integrated database retrieval system