KEGG   Mus musculus (mouse): 13639Help
Entry
13639             CDS       T01002                                 

Gene name
Efna4, EFL-4, Epl4, LERK-4
Definition
ephrin A4
Orthology
K05462  
ephrin-A
Organism
mmu  Mus musculus (mouse)
Pathway
Ras signaling pathway
Rap1 signaling pathway
PI3K-Akt signaling pathway
Axon guidance
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    13639 (Efna4)
   04015 Rap1 signaling pathway
    13639 (Efna4)
   04151 PI3K-Akt signaling pathway
    13639 (Efna4)
 Organismal Systems
  Development
   04360 Axon guidance
    13639 (Efna4)
Heparan sulfate/heparin binding proteins [BR:mmu00536]
 Axon guidance molecules
  13639 (Efna4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
3 F1; 3 39.07 cM
AA seq 206 aa AA seqDB search
MRLLPLLRTVLWAALLGSRLPGCSSLRHPIYWNSSNPRLLRGDAVVELGFNDYLDIFCPH
YESPGPPEGPETFALYMVDWSGYEACTAEGANAFQRWNCSMPFAPFSPVRFSEKIQRYTP
FPLGFEFLPGETYYYISVPTPESPGRCLRLQVSVCCKESGSSHESAHPVGSPGESGTSGW
RGGHAPSPLCLLLLLLLPILRLLRVL
NT seq 621 nt NT seq  +upstreamnt  +downstreamnt
atgcggctgctgcccctgctgcggactgtgctctgggccgcgctgctcggctcgcgcctg
ccggggtgctccagcctccgccacccaatctactggaactcctctaaccccaggttgctc
cgaggagatgccgtggtggagctgggcttcaacgattacctagacatcttctgcccacat
tatgaaagcccagggcccccagaaggcccggaaacctttgcattatacatggtggactgg
tcaggctacgaggcctgcacggcagagggggcaaatgccttccagcgctggaattgctcg
atgccttttgcccctttcagccctgttcgattctcagaaaagattcagcgctacacaccc
ttcccgctgggctttgagttcttgcctggagagacttactactacatctcggtgccgact
ccggagagtcctggccggtgcctgagactccaggtgtctgtctgctgcaaggagagcggg
tcatcacatgagtcagctcatcctgttgggagtcctggagaaagcggtacgtccgggtgg
cggggaggacacgcgcccagccccctgtgtctcttgctgctgctgctgctcccaatcctc
cgtctcctgagagttctgtga

DBGET integrated database retrieval system