KEGG   Mus musculus (mouse): 13639Help
Entry
13639             CDS       T01002                                 

Gene name
Efna4, EFL-4, Epl4, LERK-4
Definition
(RefSeq) ephrin A4
  KO
K05462  
ephrin-A
Organism
mmu  Mus musculus (mouse)
Pathway
Ras signaling pathway
Rap1 signaling pathway
PI3K-Akt signaling pathway
Axon guidance
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    13639 (Efna4)
   04015 Rap1 signaling pathway
    13639 (Efna4)
   04151 PI3K-Akt signaling pathway
    13639 (Efna4)
 Organismal Systems
  Development
   04360 Axon guidance
    13639 (Efna4)
Cytokines [BR:mmu04052]
 PDGF family
  Other growth factors
   13639 (Efna4)
Cell adhesion molecules and their ligands [BR:mmu04516]
 7. Others
  EPHA1, EPH; Eph receptor A1 [KO:K05102]
   13639 (Efna4)
  EPHA2, ECK; Eph receptor A2 [KO:K05103]
   13639 (Efna4)
  EPHA3, HEK, TYRO4; Eph receptor A3 [KO:K05104]
   13639 (Efna4)
  EPHA4, SEK, TYRO1; Eph receptor A4 [KO:K05105]
   13639 (Efna4)
  EPHA5, EHK1, TYRO4; Eph receptor A5 [KO:K05106]
   13639 (Efna4)
  EPHA6, EHK2; Eph receptor A6 [KO:K05107]
   13639 (Efna4)
  EPHA7, EHK3, HEK11; EphA7 [KO:K05108]
   13639 (Efna4)
  EPHA8, EEK; Eph receptor A8 [KO:K05109]
   13639 (Efna4)
  EPHA10; Eph receptor A10 [KO:K08897]
   13639 (Efna4)
  EPHB2, ERK, DRT; Eph receptor B2 [KO:K05111]
   13639 (Efna4)
Glycosaminoglycan binding proteins [BR:mmu00536]
 Heparan sulfate/Haparin
  Axon guidance molecules
   13639 (Efna4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
3 F1; 3 39.07 cM
AA seq 206 aa AA seqDB search
MRLLPLLRTVLWAALLGSRLPGCSSLRHPIYWNSSNPRLLRGDAVVELGFNDYLDIFCPH
YESPGPPEGPETFALYMVDWSGYEACTAEGANAFQRWNCSMPFAPFSPVRFSEKIQRYTP
FPLGFEFLPGETYYYISVPTPESPGRCLRLQVSVCCKESGSSHESAHPVGSPGESGTSGW
RGGHAPSPLCLLLLLLLPILRLLRVL
NT seq 621 nt NT seq  +upstreamnt  +downstreamnt
atgcggctgctgcccctgctgcggactgtgctctgggccgcgctgctcggctcgcgcctg
ccggggtgctccagcctccgccacccaatctactggaactcctctaaccccaggttgctc
cgaggagatgccgtggtggagctgggcttcaacgattacctagacatcttctgcccacat
tatgaaagcccagggcccccagaaggcccggaaacctttgcattatacatggtggactgg
tcaggctacgaggcctgcacggcagagggggcaaatgccttccagcgctggaattgctcg
atgccttttgcccctttcagccctgttcgattctcagaaaagattcagcgctacacaccc
ttcccgctgggctttgagttcttgcctggagagacttactactacatctcggtgccgact
ccggagagtcctggccggtgcctgagactccaggtgtctgtctgctgcaaggagagcggg
tcatcacatgagtcagctcatcctgttgggagtcctggagaaagcggtacgtccgggtgg
cggggaggacacgcgcccagccccctgtgtctcttgctgctgctgctgctcccaatcctc
cgtctcctgagagttctgtga

DBGET integrated database retrieval system