KEGG   Mus musculus (mouse): 13639Help
Entry
13639             CDS       T01002                                 

Gene name
Efna4, EFL-4, Epl4, LERK-4
Definition
(RefSeq) ephrin A4
  KO
K05462  ephrin-A
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04010  MAPK signaling pathway
mmu04014  Ras signaling pathway
mmu04015  Rap1 signaling pathway
mmu04151  PI3K-Akt signaling pathway
mmu04360  Axon guidance
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    13639 (Efna4)
   04015 Rap1 signaling pathway
    13639 (Efna4)
   04010 MAPK signaling pathway
    13639 (Efna4)
   04151 PI3K-Akt signaling pathway
    13639 (Efna4)
 Organismal Systems
  Development
   04360 Axon guidance
    13639 (Efna4)
Cytokines and growth factors [BR:mmu04052]
 Growth factors
  Growth factors (RTK binding)
   13639 (Efna4)
Glycosaminoglycan binding proteins [BR:mmu00536]
 Heparan sulfate/Haparin
  Axon guidance molecules
   13639 (Efna4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ephrin
Motif
Other DBs
NCBI-GeneID: 13639
NCBI-ProteinID: NP_031936
MGI: 106643
Ensembl: ENSMUSG00000028040
Vega: OTTMUSG00000022077
UniProt: O08542 Q3UQB5 Q9CZS8
Position
3 F1; 3 39.07 cM
AA seq 206 aa AA seqDB search
MRLLPLLRTVLWAALLGSRLPGCSSLRHPIYWNSSNPRLLRGDAVVELGFNDYLDIFCPH
YESPGPPEGPETFALYMVDWSGYEACTAEGANAFQRWNCSMPFAPFSPVRFSEKIQRYTP
FPLGFEFLPGETYYYISVPTPESPGRCLRLQVSVCCKESGSSHESAHPVGSPGESGTSGW
RGGHAPSPLCLLLLLLLPILRLLRVL
NT seq 621 nt NT seq  +upstreamnt  +downstreamnt
atgcggctgctgcccctgctgcggactgtgctctgggccgcgctgctcggctcgcgcctg
ccggggtgctccagcctccgccacccaatctactggaactcctctaaccccaggttgctc
cgaggagatgccgtggtggagctgggcttcaacgattacctagacatcttctgcccacat
tatgaaagcccagggcccccagaaggcccggaaacctttgcattatacatggtggactgg
tcaggctacgaggcctgcacggcagagggggcaaatgccttccagcgctggaattgctcg
atgccttttgcccctttcagccctgttcgattctcagaaaagattcagcgctacacaccc
ttcccgctgggctttgagttcttgcctggagagacttactactacatctcggtgccgact
ccggagagtcctggccggtgcctgagactccaggtgtctgtctgctgcaaggagagcggg
tcatcacatgagtcagctcatcctgttgggagtcctggagaaagcggtacgtccgggtgg
cggggaggacacgcgcccagccccctgtgtctcttgctgctgctgctgctcccaatcctc
cgtctcctgagagttctgtga

DBGET integrated database retrieval system