KEGG   Mus musculus (mouse): 13645Help
Entry
13645             CDS       T01002                                 

Gene name
Egf, AI790464
Definition
(RefSeq) epidermal growth factor
  KO
K04357  
epidermal growth factor
Organism
mmu  Mus musculus (mouse)
Pathway
EGFR tyrosine kinase inhibitor resistance
MAPK signaling pathway
ErbB signaling pathway
Ras signaling pathway
Rap1 signaling pathway
Cytokine-cytokine receptor interaction
HIF-1 signaling pathway
FoxO signaling pathway
Phospholipase D signaling pathway
Endocytosis
PI3K-Akt signaling pathway
Focal adhesion
Gap junction
Regulation of actin cytoskeleton
Hepatitis C
Pathways in cancer
Pancreatic cancer
Endometrial cancer
Glioma
Prostate cancer
Melanoma
Bladder cancer
Non-small cell lung cancer
Breast cancer
Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    13645 (Egf)
   04015 Rap1 signaling pathway
    13645 (Egf)
   04010 MAPK signaling pathway
    13645 (Egf)
   04012 ErbB signaling pathway
    13645 (Egf)
   04066 HIF-1 signaling pathway
    13645 (Egf)
   04068 FoxO signaling pathway
    13645 (Egf)
   04072 Phospholipase D signaling pathway
    13645 (Egf)
   04151 PI3K-Akt signaling pathway
    13645 (Egf)
  Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    13645 (Egf)
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    13645 (Egf)
  Cell motility
   04810 Regulation of actin cytoskeleton
    13645 (Egf)
  Cellular community
   04510 Focal adhesion
    13645 (Egf)
   04540 Gap junction
    13645 (Egf)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    13645 (Egf)
   05231 Choline metabolism in cancer
    13645 (Egf)
   05212 Pancreatic cancer
    13645 (Egf)
   05214 Glioma
    13645 (Egf)
   05218 Melanoma
    13645 (Egf)
   05219 Bladder cancer
    13645 (Egf)
   05215 Prostate cancer
    13645 (Egf)
   05213 Endometrial cancer
    13645 (Egf)
   05224 Breast cancer
    13645 (Egf)
   05223 Non-small cell lung cancer
    13645 (Egf)
  Infectious diseases
   05160 Hepatitis C
    13645 (Egf)
  Drug resistance
   01521 EGFR tyrosine kinase inhibitor resistance
    13645 (Egf)
Cytokines [BR:mmu04052]
 PDGF family
  Other growth factors
   13645 (Egf)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
3 G3; 3 58.5 cM
AA seq 1217 aa AA seqDB search
MPWGRRPTWLLLAFLLVFLKISILSVTAWQTGNCQPGPLERSERSGTCAGPAPFLVFSQG
KSISRIDPDGTNHQQLVVDAGISADMDIHYKKERLYWVDVERQVLLRVFLNGTGLEKVCN
VERKVSGLAIDWIDDEVLWVDQQNGVITVTDMTGKNSRVLLSSLKHPSNIAVDPIERLMF
WSSEVTGSLHRAHLKGVDVKTLLETGGISVLTLDVLDKRLFWVQDSGEGSHAYIHSCDYE
GGSVRLIRHQARHSLSSMAFFGDRIFYSVLKSKAIWIANKHTGKDTVRINLHPSFVTPGK
LMVVHPRAQPRTEDAAKDPDPELLKQRGRPCRFGLCERDPKSHSSACAEGYTLSRDRKYC
EDVNECATQNHGCTLGCENTPGSYHCTCPTGFVLLPDGKQCHELVSCPGNVSKCSHGCVL
TSDGPRCICPAGSVLGRDGKTCTGCSSPDNGGCSQICLPLRPGSWECDCFPGYDLQSDRK
SCAASGPQPLLLFANSQDIRHMHFDGTDYKVLLSRQMGMVFALDYDPVESKIYFAQTALK
WIERANMDGSQRERLITEGVDTLEGLALDWIGRRIYWTDSGKSVVGGSDLSGKHHRIIIQ
ERISRPRGIAVHPRARRLFWTDVGMSPRIESASLQGSDRVLIASSNLLEPSGITIDYLTD
TLYWCDTKRSVIEMANLDGSKRRRLIQNDVGHPFSLAVFEDHLWVSDWAIPSVIRVNKRT
GQNRVRLQGSMLKPSSLVVVHPLAKPGADPCLYRNGGCEHICQESLGTARCLCREGFVKA
WDGKMCLPQDYPILSGENADLSKEVTSLSNSTQAEVPDDDGTESSTLVAEIMVSGMNYED
DCGPGGCGSHARCVSDGETAECQCLKGFARDGNLCSDIDECVLARSDCPSTSSRCINTEG
GYVCRCSEGYEGDGISCFDIDECQRGAHNCGENAACTNTEGGYNCTCAGRPSSPGLSCPD
STAPSLLGEDGHHLDRNSYPGCPSSYDGYCLNGGVCMHIESLDSYTCNCVIGYSGDRCQT
RDLRWWELRHAGYGQKHDIMVVAVCMVALVLLLVLGMWGTYYYRTRKQLSNPPKNPCDEP
SGSVSSSGPNSSSGAAVASCPQPWFVVLEKHQDPKNGSLPADGTNGAVVDAGLSPSLQLG
SVHLTSWRQKPHIDGMGTGQSCWIPPSSDRGPQEIEGNSHLPSYRPVGPEKLHSLQSANG
SCHERAPDLPRQTEPVQ
NT seq 3654 nt NT seq  +upstreamnt  +downstreamnt
atgccctggggccgaaggccaacctggctgttgctcgccttcctgctggtgtttttaaag
attagcatactcagcgtcacagcatggcagaccgggaactgtcagccaggtcctctcgag
agaagcgagagaagcgggacttgtgccggtcctgcccccttcctagttttctcacaagga
aagagcatctctcggattgacccagatggaacaaatcaccagcaattggtggtggatgct
ggcatctcagcagacatggatattcattataaaaaagagagactctattgggtggatgta
gaaagacaagttttgctaagagttttccttaacgggacaggactagagaaagtgtgcaat
gtagagaggaaggtgtctgggctggccatagactggatagatgatgaagttctctgggta
gaccaacagaacggagtcatcaccgtaacagatatgacagggaaaaattcccgagttctt
ctaagttccttaaaacatccgtcaaatatagcagtggatccaatagagaggttgatgttt
tggtcttcagaggtgaccggcagccttcacagagcacacctcaaaggtgttgatgtaaaa
acactgctggagacagggggaatatcggtgctgactctggatgtcctggacaaacggctc
ttctgggttcaggacagtggcgaaggaagccacgcttacattcattcctgtgattatgag
ggtggctccgtccgtcttatcaggcatcaagcacggcacagtttgtcttcaatggccttt
tttggtgatcggatcttctactcagtgttgaaaagcaaggcgatttggatagccaacaaa
cacacggggaaggacacggtcaggattaacctccatccatcctttgtgacacctggaaaa
ctgatggtagtacaccctcgtgcacagcccaggacagaggacgctgctaaggatcctgac
cccgaacttctcaaacagaggggaagaccatgccgcttcggtctctgtgagcgagacccc
aagtcccactcgagcgcatgcgctgagggctacacgttaagccgagaccggaagtactgc
gaagatgtcaatgaatgtgccactcagaatcacggctgtactcttgggtgtgaaaacacc
cctggatcctatcactgcacatgccccacaggatttgttctgcttcctgatgggaaacaa
tgtcacgaacttgtttcctgcccaggcaacgtatcaaagtgcagtcatggctgtgtcctg
acatcagatggtccccggtgcatctgtcctgcaggttcagtgcttgggagagatgggaag
acttgcactggttgttcatcgcctgacaatggtggatgcagccagatctgtcttcctctc
aggccaggatcctgggaatgtgattgctttcctgggtatgacctacagtcagaccgaaag
agctgtgcagcttcaggaccacagccacttttactgtttgcaaattcccaggacatccga
cacatgcattttgatggaacagactacaaagttctgctcagccggcagatgggaatggtt
tttgccttggattatgaccctgtggaaagcaagatatattttgcacagacagccctgaag
tggatagagagggctaatatggatgggtcccagcgagaaagactgatcacagaaggagta
gatacgcttgaaggtcttgccctggactggattggccggagaatctactggacagacagt
gggaagtctgttgttggagggagcgatctgagcgggaagcatcatcgaataatcatccag
gagagaatctcgaggccgcgaggaatagctgtgcatccaagggccaggagactgttctgg
acggacgtagggatgtctccacggattgaaagcgcttcccttcaaggttccgaccgggtg
ctgatagccagctccaatctactggaacccagtggaatcacgattgactacttaacagac
actttgtactggtgtgacaccaagaggtctgtgattgaaatggccaatctggatggctcc
aaacgccgaagacttatccagaacgacgtaggtcaccccttctctctagccgtgtttgag
gatcacctgtgggtctcggattgggctatcccatcggtaataagggtgaacaagaggact
ggccaaaacagggtacgtcttcaaggcagcatgctgaagccctcgtcactggttgtggtc
catccattggcaaaaccaggtgcagatccctgcttatacaggaatggaggctgtgaacac
atctgccaagagagcctgggcacagctcggtgtttgtgtcgtgaaggttttgtgaaggcc
tgggatgggaaaatgtgtctccctcaggattatccaatcctgtcaggtgaaaatgctgat
cttagtaaagaggtgacatcactgagcaactccactcaggctgaagtaccagacgatgat
gggacagaatcttccacactagtggctgaaatcatggtgtcaggcatgaactatgaagat
gactgtggtcccggggggtgtggaagccatgctcgatgcgtttcagacggagagactgct
gagtgtcagtgtctgaaagggtttgccagggatggaaacctgtgttctgatatagatgag
tgtgtgctggctagatcggactgccccagcacctcgtccaggtgcatcaacactgaaggt
ggctacgtctgcagatgctcagaaggctacgaaggagacgggatctcctgtttcgatatt
gacgagtgccagcggggggcgcacaactgcggtgagaatgccgcctgcaccaacacggag
ggaggctacaactgcacctgcgcaggccgcccatcctcgcccggactgagttgccctgac
tctaccgcaccctctctccttggggaagatggccaccatttggaccgaaatagttatcca
ggatgcccatcctcatatgatggatactgcctcaatggtggcgtgtgcatgcatattgaa
tcactggacagctacacatgcaactgtgttattggctattctggggatcgatgccagact
cgagacctacgatggtgggaactgcgtcatgctggctacgggcagaagcatgacatcatg
gtggtggctgtctgcatggtggcactggtcctgctgctcgtcttggggatgtgggggact
tactactacaggactcggaagcagctatcaaaccccccaaagaacccttgtgatgagcca
agcggaagtgtgagcagcagcggacccaacagcagcagcggggcagctgtggcttcttgt
ccccaaccttggtttgtggtcctagagaaacaccaagaccccaagaatgggagtctgcct
gcggatggtacgaatggtgcagtagtagatgctggcctgtctccctccctgcagctcggg
tcagtgcatctgacttcatggagacagaagccccacatagatggaatgggcacagggcaa
agctgctggattccaccatcaagtgacagaggaccccaggaaatagagggaaactcccac
ctaccctcctacagacctgtggggccggagaagctgcattctctccagtcagctaatgga
tcgtgtcacgaaagggctccagacctgccacggcagacagagccagttcagtag

DBGET integrated database retrieval system