KEGG   Mus musculus (mouse): 13649Help
Entry
13649             CDS       T01002                                 

Gene name
Egfr, 9030024J15Rik, AI552599, Erbb, Errb1, Errp, Wa5, wa-2, wa2
Definition
(RefSeq) epidermal growth factor receptor (EC:2.7.10.1)
  KO
K04361  
epidermal growth factor receptor [EC:2.7.10.1]
Organism
mmu  Mus musculus (mouse)
Pathway
EGFR tyrosine kinase inhibitor resistance
MAPK signaling pathway
ErbB signaling pathway
Ras signaling pathway
Rap1 signaling pathway
Calcium signaling pathway
Cytokine-cytokine receptor interaction
HIF-1 signaling pathway
FoxO signaling pathway
Phospholipase D signaling pathway
Endocytosis
PI3K-Akt signaling pathway
Dorso-ventral axis formation
Focal adhesion
Adherens junction
Gap junction
Regulation of actin cytoskeleton
GnRH signaling pathway
Estrogen signaling pathway
Oxytocin signaling pathway
Hepatitis C
Pathways in cancer
Proteoglycans in cancer
MicroRNAs in cancer
Pancreatic cancer
Endometrial cancer
Glioma
Prostate cancer
Melanoma
Bladder cancer
Non-small cell lung cancer
Central carbon metabolism in cancer
Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    13649 (Egfr)
   04015 Rap1 signaling pathway
    13649 (Egfr)
   04010 MAPK signaling pathway
    13649 (Egfr)
   04012 ErbB signaling pathway
    13649 (Egfr)
   04066 HIF-1 signaling pathway
    13649 (Egfr)
   04068 FoxO signaling pathway
    13649 (Egfr)
   04020 Calcium signaling pathway
    13649 (Egfr)
   04072 Phospholipase D signaling pathway
    13649 (Egfr)
   04151 PI3K-Akt signaling pathway
    13649 (Egfr)
  Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    13649 (Egfr)
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    13649 (Egfr)
  Cell motility
   04810 Regulation of actin cytoskeleton
    13649 (Egfr)
  Cellular commiunity
   04510 Focal adhesion
    13649 (Egfr)
   04520 Adherens junction
    13649 (Egfr)
   04540 Gap junction
    13649 (Egfr)
 Organismal Systems
  Endocrine system
   04912 GnRH signaling pathway
    13649 (Egfr)
   04915 Estrogen signaling pathway
    13649 (Egfr)
   04921 Oxytocin signaling pathway
    13649 (Egfr)
  Development
   04320 Dorso-ventral axis formation
    13649 (Egfr)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    13649 (Egfr)
   05230 Central carbon metabolism in cancer
    13649 (Egfr)
   05231 Choline metabolism in cancer
    13649 (Egfr)
   05206 MicroRNAs in cancer
    13649 (Egfr)
   05205 Proteoglycans in cancer
    13649 (Egfr)
   05212 Pancreatic cancer
    13649 (Egfr)
   05214 Glioma
    13649 (Egfr)
   05218 Melanoma
    13649 (Egfr)
   05219 Bladder cancer
    13649 (Egfr)
   05215 Prostate cancer
    13649 (Egfr)
   05213 Endometrial cancer
    13649 (Egfr)
   05223 Non-small cell lung cancer
    13649 (Egfr)
  Infectious diseases
   05160 Hepatitis C
    13649 (Egfr)
  Antineoplastic resistance
   01521 EGFR tyrosine kinase inhibitor resistance
    13649 (Egfr)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     13649 (Egfr)
Protein kinases [BR:mmu01001]
 Tyrosine protein kinases
  EGFR family [OT]
   13649 (Egfr)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   13649 (Egfr)
  Exosomal proteins of pancreatic cancer cells
   13649 (Egfr)
  Exosomal proteins of bladder cancer cells
   13649 (Egfr)
Enzyme-linked receptors [BR:mmu01020]
 Receptor tyrosine kinases
  RTK class I (EGF receptor family)
   13649 (Egfr)
Cytokine receptors [BR:mmu04050]
 Receptor tyrosine kinase
  RTK class I (EGF receptor family)
   13649 (Egfr)
Cell adhesion molecules and their ligands [BR:mmu04516]
 1. Immunoglobulin Superfamily
  Neural system
   6/5 subfamily
    L1CAM; L1 cell adhesion molecule [KO:K06550]
     13649 (Egfr)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
11 9.41 cM; 11 A1-A4
AA seq 1210 aa AA seqDB search
MRPSGTARTTLLVLLTALCAAGGALEEKKVCQGTSNRLTQLGTFEDHFLSLQRMYNNCEV
VLGNLEITYVQRNYDLSFLKTIQEVAGYVLIALNTVERIPLENLQIIRGNALYENTYALA
ILSNYGTNRTGLRELPMRNLQEILIGAVRFSNNPILCNMDTIQWRDIVQNVFMSNMSMDL
QSHPSSCPKCDPSCPNGSCWGGGEENCQKLTKIICAQQCSHRCRGRSPSDCCHNQCAAGC
TGPRESDCLVCQKFQDEATCKDTCPPLMLYNPTTYQMDVNPEGKYSFGATCVKKCPRNYV
VTDHGSCVRACGPDYYEVEEDGIRKCKKCDGPCRKVCNGIGIGEFKDTLSINATNIKHFK
YCTAISGDLHILPVAFKGDSFTRTPPLDPRELEILKTVKEITGFLLIQAWPDNWTDLHAF
ENLEIIRGRTKQHGQFSLAVVGLNITSLGLRSLKEISDGDVIISGNRNLCYANTINWKKL
FGTPNQKTKIMNNRAEKDCKAVNHVCNPLCSSEGCWGPEPRDCVSCQNVSRGRECVEKCN
ILEGEPREFVENSECIQCHPECLPQAMNITCTGRGPDNCIQCAHYIDGPHCVKTCPAGIM
GENNTLVWKYADANNVCHLCHANCTYGCAGPGLQGCEVWPSGPKIPSIATGIVGGLLFIV
VVALGIGLFMRRRHIVRKRTLRRLLQERELVEPLTPSGEAPNQAHLRILKETEFKKIKVL
GSGAFGTVYKGLWIPEGEKVKIPVAIKELREATSPKANKEILDEAYVMASVDNPHVCRLL
GICLTSTVQLITQLMPYGCLLDYVREHKDNIGSQYLLNWCVQIAKGMNYLEDRRLVHRDL
AARNVLVKTPQHVKITDFGLAKLLGAEEKEYHAEGGKVPIKWMALESILHRIYTHQSDVW
SYGVTVWELMTFGSKPYDGIPASDISSILEKGERLPQPPICTIDVYMIMVKCWMIDADSR
PKFRELILEFSKMARDPQRYLVIQGDERMHLPSPTDSNFYRALMDEEDMEDVVDADEYLI
PQQGFFNSPSTSRTPLLSSLSATSNNSTVACINRNGSCRVKEDAFLQRYSSDPTGAVTED
NIDDAFLPVPEYVNQSVPKRPAGSVQNPVYHNQPLHPAPGRDLHYQNPHSNAVGNPEYLN
TAQPTCLSSGFNSPALWIQKGSHQMSLDNPDYQQDFFPKETKPNGIFKGPTAENAEYLRV
APPSSEFIGA
NT seq 3633 nt NT seq  +upstreamnt  +downstreamnt
atgcgaccctcagggaccgcgagaaccacactgctggtgttgctgaccgcgctctgcgcc
gcaggtggggcgttggaggaaaagaaagtctgccaaggcacaagtaacaggctcacccaa
ctgggcacttttgaagaccactttctgagcctgcagaggatgtacaacaactgtgaagtg
gtccttgggaacttggaaattacctatgtgcaaaggaattacgacctttccttcttaaag
accatccaggaggtggccggctatgtcctcattgccctcaacaccgtggagagaatccct
ttggagaacctgcagatcatcaggggaaatgctctttatgaaaacacctatgccttagcc
atcctgtccaactatgggacaaacagaactgggcttagggaactgcccatgcggaactta
caggaaatcctgattggtgctgtgcgattcagcaacaaccccatcctctgcaatatggat
actatccagtggagggacatcgtccaaaacgtctttatgagcaacatgtcaatggactta
cagagccatccgagcagttgccccaaatgtgatccaagctgtcccaatggaagctgctgg
ggaggaggagaggagaactgccagaaattgaccaaaatcatctgtgcccagcaatgttcc
catcgctgtcgtggcaggtcccccagtgactgctgccacaaccaatgtgctgcggggtgt
acagggccccgagagagtgactgtctggtctgccaaaagttccaagatgaggccacatgc
aaagacacctgcccaccactcatgctgtacaaccccaccacctatcagatggatgtcaac
cctgaagggaagtacagctttggtgccacctgtgtgaagaagtgcccccgaaactacgtg
gtgacagatcatggctcatgtgtccgagcctgtgggcctgactactacgaagtggaagaa
gatggcatccgcaagtgtaaaaaatgtgatgggccctgtcgcaaagtttgtaatggcata
ggcattggtgaatttaaagacacactctccataaatgctacaaacatcaaacacttcaaa
tactgcactgccatcagcggggaccttcacatcctgccagtggcctttaagggggattct
ttcacgcgcactcctcctctagacccacgagaactagaaattctaaaaaccgtaaaggaa
ataacaggctttttgctgattcaggcttggcctgataactggactgacctccatgctttc
gagaacctagaaataatacgtggcagaacaaagcaacatggtcagttttctttggcggtc
gttggcctgaacatcacatcactggggctgcgttccctcaaggagatcagtgatggggat
gtgatcatttctggaaaccgaaatttgtgctacgcaaacacaataaactggaaaaaactc
ttcgggacacccaatcagaaaaccaaaatcatgaacaacagagctgagaaagactgcaag
gccgtgaaccacgtctgcaatcctttatgctcctcggaaggctgctggggccctgagccc
agggactgtgtctcctgccagaatgtgagcagaggcagggagtgcgtggagaaatgcaac
atcctggagggggaaccaagggagtttgtggaaaattctgaatgcatccagtgccatcca
gaatgtctgccccaggccatgaacatcacctgtacaggcaggggaccagacaactgcatc
cagtgtgcccactacattgatggcccacactgtgtcaagacctgcccagctggcatcatg
ggagagaacaacactctggtctggaagtatgcagatgccaataatgtctgccacctatgc
cacgccaactgtacctatggatgtgctgggccaggtcttcaaggatgtgaagtgtggcca
tctgggccaaagataccatctattgccactgggattgtgggtggcctcctcttcatagtg
gtggtggcccttgggattggcctattcatgcgaagacgtcacattgttcgaaagcgtaca
ctacgccgcctgcttcaagagagagagctcgtggaacctctcacacccagcggagaagct
ccaaaccaagcccacttgaggatattaaaggaaacagaattcaaaaagatcaaagttctg
ggttcgggagcatttggcacagtgtataagggtctctggatcccagaaggtgagaaagta
aaaatcccggtggccatcaaggagttaagagaagccacatctccaaaagccaacaaagaa
atccttgacgaagcctatgtgatggctagtgtggacaaccctcatgtatgccgcctcctg
ggcatctgtctgacctccactgtccagctcattacacagctcatgccctacggttgcctc
ctggactacgtccgagaacacaaggacaacattggctcccagtacctcctcaactggtgt
gtgcagattgcaaagggcatgaactacctggaagatcggcgtttggtgcaccgtgacttg
gcagccaggaatgtactggtgaagacaccacagcatgtcaagatcacagattttgggctg
gccaaactgcttggtgctgaagagaaagaatatcatgccgaggggggcaaagtgcctatc
aagtggatggctttggaatcaattttacaccgaatttatacacaccaaagtgatgtctgg
agctatggtgtcactgtgtgggaactgatgacctttgggtccaagccttatgatggaatc
ccagcaagtgacatctcatccatcctagagaaaggagagcgccttccacagccacctatc
tgcaccatcgatgtctacatgatcatggtcaagtgctggatgatagatgctgatagccgc
ccaaagttccgagagttgattcttgaattctccaaaatggcccgagacccacagcgctac
cttgttatccagggggatgaaagaatgcatttgccaagccctacagactccaacttttac
cgagccctgatggatgaagaggacatggaggatgtagttgatgctgatgagtatcttatc
ccacagcaaggcttcttcaacagcccgtccacgtcgaggactcccctcttgagttctctg
agtgcaactagcaacaattccactgtggcttgcattaatagaaatgggagctgccgtgtc
aaagaagacgccttcttgcagcggtacagctccgaccccacaggtgctgtaacagaggac
aacatagatgacgcattcctccctgtacctgaatatgtaaaccaatctgttcccaagagg
ccagcaggctctgtgcagaaccctgtctatcacaatcagcccctgcatccagctcctgga
agagacctgcattatcaaaatccccacagcaatgcagtgggcaaccctgagtatctcaac
actgcccagcctacctgtctcagtagtgggtttaacagccctgcactctggatccagaaa
ggcagtcaccaaatgagcctagacaaccctgactaccagcaggacttcttccccaaggaa
accaagccaaatggcatatttaagggccccacagctgaaaatgcagagtacctacgggtg
gcacctccaagcagtgagtttattggagcatga

DBGET integrated database retrieval system