KEGG   Mus musculus (mouse): 13649Help
Entry
13649             CDS       T01002                                 

Gene name
Egfr, 9030024J15Rik, AI552599, Erbb, Errb1, Errp, Wa5, wa-2, wa2
Definition
(RefSeq) epidermal growth factor receptor
  KO
K04361  epidermal growth factor receptor [EC:2.7.10.1]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu01521  EGFR tyrosine kinase inhibitor resistance
mmu01522  Endocrine resistance
mmu04010  MAPK signaling pathway
mmu04012  ErbB signaling pathway
mmu04014  Ras signaling pathway
mmu04015  Rap1 signaling pathway
mmu04020  Calcium signaling pathway
mmu04060  Cytokine-cytokine receptor interaction
mmu04066  HIF-1 signaling pathway
mmu04068  FoxO signaling pathway
mmu04072  Phospholipase D signaling pathway
mmu04144  Endocytosis
mmu04151  PI3K-Akt signaling pathway
mmu04510  Focal adhesion
mmu04520  Adherens junction
mmu04540  Gap junction
mmu04630  Jak-STAT signaling pathway
mmu04810  Regulation of actin cytoskeleton
mmu04912  GnRH signaling pathway
mmu04915  Estrogen signaling pathway
mmu04921  Oxytocin signaling pathway
mmu04926  Relaxin signaling pathway
mmu04928  Parathyroid hormone synthesis, secretion and action
mmu04934  Cushing's syndrome
mmu05160  Hepatitis C
mmu05165  Human papillomavirus infection
mmu05200  Pathways in cancer
mmu05205  Proteoglycans in cancer
mmu05206  MicroRNAs in cancer
mmu05210  Colorectal cancer
mmu05212  Pancreatic cancer
mmu05213  Endometrial cancer
mmu05214  Glioma
mmu05215  Prostate cancer
mmu05218  Melanoma
mmu05219  Bladder cancer
mmu05223  Non-small cell lung cancer
mmu05224  Breast cancer
mmu05225  Hepatocellular carcinoma
mmu05226  Gastric cancer
mmu05230  Central carbon metabolism in cancer
mmu05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    13649 (Egfr)
   04015 Rap1 signaling pathway
    13649 (Egfr)
   04010 MAPK signaling pathway
    13649 (Egfr)
   04012 ErbB signaling pathway
    13649 (Egfr)
   04630 Jak-STAT signaling pathway
    13649 (Egfr)
   04066 HIF-1 signaling pathway
    13649 (Egfr)
   04068 FoxO signaling pathway
    13649 (Egfr)
   04020 Calcium signaling pathway
    13649 (Egfr)
   04072 Phospholipase D signaling pathway
    13649 (Egfr)
   04151 PI3K-Akt signaling pathway
    13649 (Egfr)
  Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    13649 (Egfr)
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    13649 (Egfr)
  Cellular community - eukaryotes
   04510 Focal adhesion
    13649 (Egfr)
   04520 Adherens junction
    13649 (Egfr)
   04540 Gap junction
    13649 (Egfr)
  Cell motility
   04810 Regulation of actin cytoskeleton
    13649 (Egfr)
 Organismal Systems
  Endocrine system
   04912 GnRH signaling pathway
    13649 (Egfr)
   04915 Estrogen signaling pathway
    13649 (Egfr)
   04921 Oxytocin signaling pathway
    13649 (Egfr)
   04926 Relaxin signaling pathway
    13649 (Egfr)
   04928 Parathyroid hormone synthesis, secretion and action
    13649 (Egfr)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    13649 (Egfr)
   05230 Central carbon metabolism in cancer
    13649 (Egfr)
   05231 Choline metabolism in cancer
    13649 (Egfr)
   05206 MicroRNAs in cancer
    13649 (Egfr)
   05205 Proteoglycans in cancer
    13649 (Egfr)
   05210 Colorectal cancer
    13649 (Egfr)
   05212 Pancreatic cancer
    13649 (Egfr)
   05225 Hepatocellular carcinoma
    13649 (Egfr)
   05226 Gastric cancer
    13649 (Egfr)
   05214 Glioma
    13649 (Egfr)
   05218 Melanoma
    13649 (Egfr)
   05219 Bladder cancer
    13649 (Egfr)
   05215 Prostate cancer
    13649 (Egfr)
   05213 Endometrial cancer
    13649 (Egfr)
   05224 Breast cancer
    13649 (Egfr)
   05223 Non-small cell lung cancer
    13649 (Egfr)
  Endocrine and metabolic diseases
   04934 Cushing's syndrome
    13649 (Egfr)
  Infectious diseases
   05160 Hepatitis C
    13649 (Egfr)
   05165 Human papillomavirus infection
    13649 (Egfr)
  Drug resistance
   01521 EGFR tyrosine kinase inhibitor resistance
    13649 (Egfr)
   01522 Endocrine resistance
    13649 (Egfr)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     13649 (Egfr)
Protein kinases [BR:mmu01001]
 Receptor tyrosine kinases (RTK)
  EGFR family [OT]
   13649 (Egfr)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   13649 (Egfr)
  Exosomal proteins of pancreatic cancer cells
   13649 (Egfr)
  Exosomal proteins of bladder cancer cells
   13649 (Egfr)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Recep_L_domain GF_recep_IV Pkinase Furin-like APH Kinase-like Haspin_kinase
Motif
Other DBs
NCBI-GeneID: 13649
NCBI-ProteinID: NP_997538
MGI: 95294
Ensembl: ENSMUSG00000020122
Vega: OTTMUSG00000005185
UniProt: Q01279 Q9EP98 Q9WVF5 Q3TQS6
Position
11 A2; 11 9.41 cM
AA seq 1210 aa AA seqDB search
MRPSGTARTTLLVLLTALCAAGGALEEKKVCQGTSNRLTQLGTFEDHFLSLQRMYNNCEV
VLGNLEITYVQRNYDLSFLKTIQEVAGYVLIALNTVERIPLENLQIIRGNALYENTYALA
ILSNYGTNRTGLRELPMRNLQEILIGAVRFSNNPILCNMDTIQWRDIVQNVFMSNMSMDL
QSHPSSCPKCDPSCPNGSCWGGGEENCQKLTKIICAQQCSHRCRGRSPSDCCHNQCAAGC
TGPRESDCLVCQKFQDEATCKDTCPPLMLYNPTTYQMDVNPEGKYSFGATCVKKCPRNYV
VTDHGSCVRACGPDYYEVEEDGIRKCKKCDGPCRKVCNGIGIGEFKDTLSINATNIKHFK
YCTAISGDLHILPVAFKGDSFTRTPPLDPRELEILKTVKEITGFLLIQAWPDNWTDLHAF
ENLEIIRGRTKQHGQFSLAVVGLNITSLGLRSLKEISDGDVIISGNRNLCYANTINWKKL
FGTPNQKTKIMNNRAEKDCKAVNHVCNPLCSSEGCWGPEPRDCVSCQNVSRGRECVEKCN
ILEGEPREFVENSECIQCHPECLPQAMNITCTGRGPDNCIQCAHYIDGPHCVKTCPAGIM
GENNTLVWKYADANNVCHLCHANCTYGCAGPGLQGCEVWPSGPKIPSIATGIVGGLLFIV
VVALGIGLFMRRRHIVRKRTLRRLLQERELVEPLTPSGEAPNQAHLRILKETEFKKIKVL
GSGAFGTVYKGLWIPEGEKVKIPVAIKELREATSPKANKEILDEAYVMASVDNPHVCRLL
GICLTSTVQLITQLMPYGCLLDYVREHKDNIGSQYLLNWCVQIAKGMNYLEDRRLVHRDL
AARNVLVKTPQHVKITDFGLAKLLGAEEKEYHAEGGKVPIKWMALESILHRIYTHQSDVW
SYGVTVWELMTFGSKPYDGIPASDISSILEKGERLPQPPICTIDVYMIMVKCWMIDADSR
PKFRELILEFSKMARDPQRYLVIQGDERMHLPSPTDSNFYRALMDEEDMEDVVDADEYLI
PQQGFFNSPSTSRTPLLSSLSATSNNSTVACINRNGSCRVKEDAFLQRYSSDPTGAVTED
NIDDAFLPVPEYVNQSVPKRPAGSVQNPVYHNQPLHPAPGRDLHYQNPHSNAVGNPEYLN
TAQPTCLSSGFNSPALWIQKGSHQMSLDNPDYQQDFFPKETKPNGIFKGPTAENAEYLRV
APPSSEFIGA
NT seq 3633 nt NT seq  +upstreamnt  +downstreamnt
atgcgaccctcagggaccgcgagaaccacactgctggtgttgctgaccgcgctctgcgcc
gcaggtggggcgttggaggaaaagaaagtctgccaaggcacaagtaacaggctcacccaa
ctgggcacttttgaagaccactttctgagcctgcagaggatgtacaacaactgtgaagtg
gtccttgggaacttggaaattacctatgtgcaaaggaattacgacctttccttcttaaag
accatccaggaggtggccggctatgtcctcattgccctcaacaccgtggagagaatccct
ttggagaacctgcagatcatcaggggaaatgctctttatgaaaacacctatgccttagcc
atcctgtccaactatgggacaaacagaactgggcttagggaactgcccatgcggaactta
caggaaatcctgattggtgctgtgcgattcagcaacaaccccatcctctgcaatatggat
actatccagtggagggacatcgtccaaaacgtctttatgagcaacatgtcaatggactta
cagagccatccgagcagttgccccaaatgtgatccaagctgtcccaatggaagctgctgg
ggaggaggagaggagaactgccagaaattgaccaaaatcatctgtgcccagcaatgttcc
catcgctgtcgtggcaggtcccccagtgactgctgccacaaccaatgtgctgcggggtgt
acagggccccgagagagtgactgtctggtctgccaaaagttccaagatgaggccacatgc
aaagacacctgcccaccactcatgctgtacaaccccaccacctatcagatggatgtcaac
cctgaagggaagtacagctttggtgccacctgtgtgaagaagtgcccccgaaactacgtg
gtgacagatcatggctcatgtgtccgagcctgtgggcctgactactacgaagtggaagaa
gatggcatccgcaagtgtaaaaaatgtgatgggccctgtcgcaaagtttgtaatggcata
ggcattggtgaatttaaagacacactctccataaatgctacaaacatcaaacacttcaaa
tactgcactgccatcagcggggaccttcacatcctgccagtggcctttaagggggattct
ttcacgcgcactcctcctctagacccacgagaactagaaattctaaaaaccgtaaaggaa
ataacaggctttttgctgattcaggcttggcctgataactggactgacctccatgctttc
gagaacctagaaataatacgtggcagaacaaagcaacatggtcagttttctttggcggtc
gttggcctgaacatcacatcactggggctgcgttccctcaaggagatcagtgatggggat
gtgatcatttctggaaaccgaaatttgtgctacgcaaacacaataaactggaaaaaactc
ttcgggacacccaatcagaaaaccaaaatcatgaacaacagagctgagaaagactgcaag
gccgtgaaccacgtctgcaatcctttatgctcctcggaaggctgctggggccctgagccc
agggactgtgtctcctgccagaatgtgagcagaggcagggagtgcgtggagaaatgcaac
atcctggagggggaaccaagggagtttgtggaaaattctgaatgcatccagtgccatcca
gaatgtctgccccaggccatgaacatcacctgtacaggcaggggaccagacaactgcatc
cagtgtgcccactacattgatggcccacactgtgtcaagacctgcccagctggcatcatg
ggagagaacaacactctggtctggaagtatgcagatgccaataatgtctgccacctatgc
cacgccaactgtacctatggatgtgctgggccaggtcttcaaggatgtgaagtgtggcca
tctgggccaaagataccatctattgccactgggattgtgggtggcctcctcttcatagtg
gtggtggcccttgggattggcctattcatgcgaagacgtcacattgttcgaaagcgtaca
ctacgccgcctgcttcaagagagagagctcgtggaacctctcacacccagcggagaagct
ccaaaccaagcccacttgaggatattaaaggaaacagaattcaaaaagatcaaagttctg
ggttcgggagcatttggcacagtgtataagggtctctggatcccagaaggtgagaaagta
aaaatcccggtggccatcaaggagttaagagaagccacatctccaaaagccaacaaagaa
atccttgacgaagcctatgtgatggctagtgtggacaaccctcatgtatgccgcctcctg
ggcatctgtctgacctccactgtccagctcattacacagctcatgccctacggttgcctc
ctggactacgtccgagaacacaaggacaacattggctcccagtacctcctcaactggtgt
gtgcagattgcaaagggcatgaactacctggaagatcggcgtttggtgcaccgtgacttg
gcagccaggaatgtactggtgaagacaccacagcatgtcaagatcacagattttgggctg
gccaaactgcttggtgctgaagagaaagaatatcatgccgaggggggcaaagtgcctatc
aagtggatggctttggaatcaattttacaccgaatttatacacaccaaagtgatgtctgg
agctatggtgtcactgtgtgggaactgatgacctttgggtccaagccttatgatggaatc
ccagcaagtgacatctcatccatcctagagaaaggagagcgccttccacagccacctatc
tgcaccatcgatgtctacatgatcatggtcaagtgctggatgatagatgctgatagccgc
ccaaagttccgagagttgattcttgaattctccaaaatggcccgagacccacagcgctac
cttgttatccagggggatgaaagaatgcatttgccaagccctacagactccaacttttac
cgagccctgatggatgaagaggacatggaggatgtagttgatgctgatgagtatcttatc
ccacagcaaggcttcttcaacagcccgtccacgtcgaggactcccctcttgagttctctg
agtgcaactagcaacaattccactgtggcttgcattaatagaaatgggagctgccgtgtc
aaagaagacgccttcttgcagcggtacagctccgaccccacaggtgctgtaacagaggac
aacatagatgacgcattcctccctgtacctgaatatgtaaaccaatctgttcccaagagg
ccagcaggctctgtgcagaaccctgtctatcacaatcagcccctgcatccagctcctgga
agagacctgcattatcaaaatccccacagcaatgcagtgggcaaccctgagtatctcaac
actgcccagcctacctgtctcagtagtgggtttaacagccctgcactctggatccagaaa
ggcagtcaccaaatgagcctagacaaccctgactaccagcaggacttcttccccaaggaa
accaagccaaatggcatatttaagggccccacagctgaaaatgcagagtacctacgggtg
gcacctccaagcagtgagtttattggagcatga

DBGET integrated database retrieval system