KEGG   Mus musculus (mouse): 13653Help
Entry
13653             CDS       T01002                                 

Gene name
Egr1, A530045N19Rik, ETR103, Egr-1, Krox-1, Krox-24, Krox24, NGF1-A, NGFI-A, NGFIA, TIS8, Zenk, Zfp-6, Zif268, egr
Definition
(RefSeq) early growth response 1
  KO
K09203  early growth response protein 1
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04371  Apelin signaling pathway
mmu04912  GnRH signaling pathway
mmu04928  Parathyroid hormone synthesis, secretion and action
mmu04933  AGE-RAGE signaling pathway in diabetic complications
mmu05020  Prion diseases
mmu05166  HTLV-I infection
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Environmental Information Processing
  Signal transduction
   04371 Apelin signaling pathway
    13653 (Egr1)
 Organismal Systems
  Endocrine system
   04912 GnRH signaling pathway
    13653 (Egr1)
   04928 Parathyroid hormone synthesis, secretion and action
    13653 (Egr1)
 Human Diseases
  Neurodegenerative diseases
   05020 Prion diseases
    13653 (Egr1)
  Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    13653 (Egr1)
  Infectious diseases
   05166 HTLV-I infection
    13653 (Egr1)
Transcription factors [BR:mmu03000]
 Eukaryotic Type
  Zinc finger
   Cys2His2 developmental/cell cycle regulators, Egr/Krox
    13653 (Egr1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DUF3432 DUF3446 zf-H2C2_2 zf-C2H2 zf-C2H2_4 zf-C2HC_2 zf-BED Zf_RING zf-C2H2_8 zf-H2C2_5
Motif
Other DBs
NCBI-GeneID: 13653
NCBI-ProteinID: NP_031939
MGI: 95295
Ensembl: ENSMUSG00000038418
Vega: OTTMUSG00000021064
UniProt: P08046 Q544D6 Q8CAT6
Structure
PDB: 

Jmol
Position
18 B1; 18 18.76 cM
AA seq 533 aa AA seqDB search
MAAAKAEMQLMSPLQISDPFGSFPHSPTMDNYPKLEEMMLLSNGAPQFLGAAGTPEGSGG
NSSSSTSSGGGGGGGSNSGSSAFNPQGEPSEQPYEHLTTESFSDIALNNEKAMVETSYPS
QTTRLPPITYTGRFSLEPAPNSGNTLWPEPLFSLVSGLVSMTNPPTSSSSAPSPAASSSS
SASQSPPLSCAVPSNDSSPIYSAAPTFPTPNTDIFPEPQSQAFPGSAGTALQYPPPAYPA
TKGGFQVPMIPDYLFPQQQGDLSLGTPDQKPFQGLENRTQQPSLTPLSTIKAFATQSGSQ
DLKALNTTYQSQLIKPSRMRKYPNRPSKTPPHERPYACPVESCDRRFSRSDELTRHIRIH
TGQKPFQCRICMRNFSRSDHLTTHIRTHTGEKPFACDICGRKFARSDERKRHTKIHLRQK
DKKADKSVVASPAASSLSSYPSPVATSYPSPATTSFPSPVPTSYSSPGSSTYPSPAHSGF
PSPSVATTFASVPPAFPTQVSSFPSAGVSSSFSTSTGLSDMTATFSPRTIEIC
NT seq 1602 nt NT seq  +upstreamnt  +downstreamnt
atggcagcggccaaggccgagatgcaattgatgtctccgctgcagatctctgacccgttc
ggctcctttcctcactcacccaccatggacaactaccccaaactggaggagatgatgctg
ctgagcaacggggctccccagttcctcggtgctgccggaaccccagagggcagcggcggt
aatagcagcagcagcaccagcagcgggggcggtggtgggggcggcagcaacagcggcagc
agcgccttcaatcctcaaggggagccgagcgaacaaccctatgagcacctgaccacagag
tccttttctgacatcgctctgaataatgagaaggcgatggtggagacgagttatcccagc
caaacgactcggttgcctcccatcacctatactggccgcttctccctggagcccgcaccc
aacagtggcaacactttgtggcctgaaccccttttcagcctagtcagtggcctcgtgagc
atgaccaatcctccgacctcttcatcctcggcgccttctccagctgcttcatcgtcttcc
tctgcctcccagagcccgcccctgagctgtgccgtgccgtccaacgacagcagtcccatc
tactcggctgcgcccacctttcctactcccaacactgacatttttcctgagccccaaagc
caggcctttcctggctcggcaggcacagccttgcagtacccgcctcctgcctaccctgcc
accaaaggtggtttccaggttcccatgatccctgactatctgtttccacaacaacaggga
gacctgagcctgggcaccccagaccagaagcccttccagggtctggagaaccgtacccag
cagccttcgctcactccactatccactattaaagccttcgccactcagtcgggctcccag
gacttaaaggctcttaataccacctaccaatcccagctcatcaaacccagccgcatgcgc
aagtaccccaaccggcccagcaagacacccccccatgaacgcccatatgcttgccctgtc
gagtcctgcgatcgccgcttttctcgctcggatgagcttacccgccatatccgcatccac
acaggccagaagcccttccagtgtcgaatctgcatgcgtaacttcagtcgtagtgaccac
cttaccacccacatccgcacccacacaggcgagaagccttttgcctgtgacatttgtggg
aggaagtttgccaggagtgatgaacgcaagaggcataccaaaatccatttaagacagaag
gacaagaaagcagacaaaagtgtggtggcctccccggctgcctcttcactctcttcttac
ccatccccagtggctacctcctacccatcccctgccaccacctcattcccatcccctgtg
cccacttcctactcctctcctggctcctccacctacccatctcctgcgcacagtggcttc
ccgtcgccgtcagtggccaccacctttgcctccgttccacctgctttccccacccaggtc
agcagcttcccgtctgcgggcgtcagcagctccttcagcacctcaactggtctttcagac
atgacagcgaccttttctcccaggacaattgaaatttgctaa

DBGET integrated database retrieval system