KEGG   Mus musculus (mouse): 13653Help
Entry
13653             CDS       T01002                                 

Gene name
Egr1, A530045N19Rik, ETR103, Egr-1, Krox-1, Krox-24, Krox24, NGF1-A, NGFI-A, NGFIA, TIS8, Zenk, Zfp-6, Zif268, egr
Definition
(RefSeq) early growth response 1
  KO
K09203  
early growth response protein 1
Organism
mmu  Mus musculus (mouse)
Pathway
AGE-RAGE signaling pathway in diabetic complications
Prion diseases
HTLV-I infection
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Human Diseases
  Neurodegenerative diseases
   05020 Prion diseases
    13653 (Egr1)
  Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    13653 (Egr1)
  Infectious diseases
   05166 HTLV-I infection
    13653 (Egr1)
Transcription factors [BR:mmu03000]
 Eukaryotic Type
  Zinc finger
   Cys2His2 developmental/cell cycle regulators, Egr/Krox
    13653 (Egr1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
18 18.76 cM; 18 C/D
AA seq 533 aa AA seqDB search
MAAAKAEMQLMSPLQISDPFGSFPHSPTMDNYPKLEEMMLLSNGAPQFLGAAGTPEGSGG
NSSSSTSSGGGGGGGSNSGSSAFNPQGEPSEQPYEHLTTESFSDIALNNEKAMVETSYPS
QTTRLPPITYTGRFSLEPAPNSGNTLWPEPLFSLVSGLVSMTNPPTSSSSAPSPAASSSS
SASQSPPLSCAVPSNDSSPIYSAAPTFPTPNTDIFPEPQSQAFPGSAGTALQYPPPAYPA
TKGGFQVPMIPDYLFPQQQGDLSLGTPDQKPFQGLENRTQQPSLTPLSTIKAFATQSGSQ
DLKALNTTYQSQLIKPSRMRKYPNRPSKTPPHERPYACPVESCDRRFSRSDELTRHIRIH
TGQKPFQCRICMRNFSRSDHLTTHIRTHTGEKPFACDICGRKFARSDERKRHTKIHLRQK
DKKADKSVVASPAASSLSSYPSPVATSYPSPATTSFPSPVPTSYSSPGSSTYPSPAHSGF
PSPSVATTFASVPPAFPTQVSSFPSAGVSSSFSTSTGLSDMTATFSPRTIEIC
NT seq 1602 nt NT seq  +upstreamnt  +downstreamnt
atggcagcggccaaggccgagatgcaattgatgtctccgctgcagatctctgacccgttc
ggctcctttcctcactcacccaccatggacaactaccccaaactggaggagatgatgctg
ctgagcaacggggctccccagttcctcggtgctgccggaaccccagagggcagcggcggt
aatagcagcagcagcaccagcagcgggggcggtggtgggggcggcagcaacagcggcagc
agcgccttcaatcctcaaggggagccgagcgaacaaccctatgagcacctgaccacagag
tccttttctgacatcgctctgaataatgagaaggcgatggtggagacgagttatcccagc
caaacgactcggttgcctcccatcacctatactggccgcttctccctggagcccgcaccc
aacagtggcaacactttgtggcctgaaccccttttcagcctagtcagtggcctcgtgagc
atgaccaatcctccgacctcttcatcctcggcgccttctccagctgcttcatcgtcttcc
tctgcctcccagagcccgcccctgagctgtgccgtgccgtccaacgacagcagtcccatc
tactcggctgcgcccacctttcctactcccaacactgacatttttcctgagccccaaagc
caggcctttcctggctcggcaggcacagccttgcagtacccgcctcctgcctaccctgcc
accaaaggtggtttccaggttcccatgatccctgactatctgtttccacaacaacaggga
gacctgagcctgggcaccccagaccagaagcccttccagggtctggagaaccgtacccag
cagccttcgctcactccactatccactattaaagccttcgccactcagtcgggctcccag
gacttaaaggctcttaataccacctaccaatcccagctcatcaaacccagccgcatgcgc
aagtaccccaaccggcccagcaagacacccccccatgaacgcccatatgcttgccctgtc
gagtcctgcgatcgccgcttttctcgctcggatgagcttacccgccatatccgcatccac
acaggccagaagcccttccagtgtcgaatctgcatgcgtaacttcagtcgtagtgaccac
cttaccacccacatccgcacccacacaggcgagaagccttttgcctgtgacatttgtggg
aggaagtttgccaggagtgatgaacgcaagaggcataccaaaatccatttaagacagaag
gacaagaaagcagacaaaagtgtggtggcctccccggctgcctcttcactctcttcttac
ccatccccagtggctacctcctacccatcccctgccaccacctcattcccatcccctgtg
cccacttcctactcctctcctggctcctccacctacccatctcctgcgcacagtggcttc
ccgtcgccgtcagtggccaccacctttgcctccgttccacctgctttccccacccaggtc
agcagcttcccgtctgcgggcgtcagcagctccttcagcacctcaactggtctttcagac
atgacagcgaccttttctcccaggacaattgaaatttgctaa

DBGET integrated database retrieval system