KEGG   Mus musculus (mouse): 13655Help
Entry
13655             CDS       T01002                                 

Gene name
Egr3, Pilot
Definition
(RefSeq) early growth response 3
  KO
K12497  
early growth response protein 3
Organism
mmu  Mus musculus (mouse)
Pathway
Hepatitis B
Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Human Diseases
  Cancers
   05203 Viral carcinogenesis
    13655 (Egr3)
  Infectious diseases
   05161 Hepatitis B
    13655 (Egr3)
Transcription factors [BR:mmu03000]
 Eukaryotic Type
  Zinc finger
   Cys2His2 developmental/cell cycle regulators, Egr/Krox
    13655 (Egr3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
UniProt: 
Position
14; 14 D2
AA seq 387 aa AA seqDB search
MTGKLAEKLPVTMSSLLNQLPDNLYPEEIPSALNLFSGSSDSVAHYNQMATENVMDIGLT
NEKPNPELSYSSSFQPAPGNKTVTYLGKFAFDSPSNWCQDNIISLMSAGILGVPPASGAL
STQTSTASMVQPPQGDVEAMYPALPPYSNCGDLYSEPVSFHDPQGNPGLAYSPQDYQSAK
PALDSNLFPMIPDYNLYHHPNDMGSIPEHKPFQGMDPIRVNPPPITPLETIKAFKDKQIH
PGFGSLPQPPLTLKPIRPRKYPNRPSKTPLHERPHACPAEGCDRRFSRSDELTRHLRIHT
GHKPFQCRICMRSFSRSDHLTTHIRTHTGEKPFACEFCGRKFARSDERKRHAKIHLKQKE
KKSEKGGAPSASSAPTVSLAPVVTTCA
NT seq 1164 nt NT seq  +upstreamnt  +downstreamnt
atgaccggcaaactcgccgagaagctgccggtgaccatgagcagtttgctaaatcaattg
cctgacaatctgtaccccgaggagatccccagcgcgctcaacctcttctccggcagcagc
gactcggtagcccattacaatcagatggctacagagaatgtgatggacatcggtctgacc
aacgagaagcccaatccggaactctcttattcgagctctttccagccagcccccggcaac
aagaccgtgacctacttgggaaagttcgctttcgactctccttccaactggtgccaggac
aacatcattagcctcatgagtgccggcatcttgggggtgcccccggcctcaggggcgctc
agtacgcagacgtccacggctagcatggtgcagcctcctcagggagacgtggaggccatg
tatccggcgctgcctccttattccaactgcggcgatctctactcggagcccgtgtctttc
cacgacccccagggaaaccctgggctcgcctattccccccaggattaccaatcggccaag
ccggccttggacagcaatcttttccccatgattcctgactacaacctgtaccaccatccc
aacgacatgggctccattccggaacataagcccttccagggcatggaccccatccgggtc
aacccaccccctattaccccactggagaccatcaaggccttcaaagacaagcagatccac
ccgggattcggcagcctgccccaaccgccgctcactctcaagcccatccggccccgcaag
taccccaatcggcctagcaagaccccgctccacgagcggccccacgcgtgtcccgcggaa
ggctgtgaccgccgtttcagccgctcagacgagctgacccggcacctgcgcatccacacg
ggccacaagcccttccagtgtcggatctgcatgcgcagcttcagccgcagcgaccacctc
accactcacatccgcacgcacaccggggagaagccctttgcctgtgagttctgtgggcgc
aagtttgcgcgcagcgacgagcgcaagcgccacgccaagatccacctcaagcaaaaggag
aagaagtcggagaaagggggtgcgccctctgcatcctcggcgcccaccgtgtccctggcc
cctgtggtcaccacctgcgcctga

DBGET integrated database retrieval system