KEGG   Mus musculus (mouse): 13666Help
Entry
13666             CDS       T01002                                 

Gene name
Eif2ak3, Pek, Perk
Definition
(RefSeq) eukaryotic translation initiation factor 2 alpha kinase 3 (EC:2.7.11.1)
  KO
K08860  
eukaryotic translation initiation factor 2-alpha kinase 3 [EC:2.7.11.1]
Organism
mmu  Mus musculus (mouse)
Pathway
Protein processing in endoplasmic reticulum
Apoptosis
Non-alcoholic fatty liver disease (NAFLD)
Alzheimer's disease
Hepatitis C
Measles
Influenza A
Herpes simplex infection
Epstein-Barr virus infection
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    13666 (Eif2ak3)
 Cellular Processes
  Cell growth and death
   04210 Apoptosis
    13666 (Eif2ak3)
 Human Diseases
  Neurodegenerative diseases
   05010 Alzheimer's disease
    13666 (Eif2ak3)
  Endocrine and metabolic diseases
   04932 Non-alcoholic fatty liver disease (NAFLD)
    13666 (Eif2ak3)
  Infectious diseases
   05162 Measles
    13666 (Eif2ak3)
   05164 Influenza A
    13666 (Eif2ak3)
   05160 Hepatitis C
    13666 (Eif2ak3)
   05168 Herpes simplex infection
    13666 (Eif2ak3)
   05169 Epstein-Barr virus infection
    13666 (Eif2ak3)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     13666 (Eif2ak3)
Protein kinases [BR:mmu01001]
 Serine/threonine protein kinases: Other group
  PEK family [OT]
   13666 (Eif2ak3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
6; 6 C1
AA seq 152 aa AA seqDB search
MERATRPGPRALLLLLFLLLGCAAGISAVAPARSLLAPASETVFGLGAAAAPTSAARVPA
VATAEVTVEDAEALPAAAGEPESRATEPDDDVELRPRGRSLVIISTLDGRIAALDAENDG
KKQWDLDVGSGSLVSSSLSKPEGTHKTSSKEC
NT seq 459 nt NT seq  +upstreamnt  +downstreamnt
atggagcgcgccacccggcccgggccgcgcgcgctgctgctgcttctgttcctgctgctg
ggctgcgcggcggggatctcggcggtcgcgcccgcccgcagtttgcttgctcccgcgtcg
gagacagtgtttggcttaggggcagcggccgccccgacttcggccgcgcgggtgcctgcg
gtggcaacggccgaagtgaccgtggaggacgccgaggcattgccggctgccgctggcgaa
ccggagtcacgcgcgacggagcccgatgacgacgtggaactgcggcctcgcggcaggtcc
ttggtaatcatcagcactttagatggacgaatcgctgcactggatgccgagaatgatggg
aaaaagcagtgggatttggacgtggggtctggttccttggtttcatctagcctcagcaag
ccagagggcacccacaaaacttcctcaaaagaatgttga

DBGET integrated database retrieval system