KEGG   Mus musculus (mouse): 13666Help
Entry
13666             CDS       T01002                                 

Gene name
Eif2ak3, Pek, Perk
Definition
(RefSeq) eukaryotic translation initiation factor 2 alpha kinase 3
  KO
K08860  eukaryotic translation initiation factor 2-alpha kinase 3 [EC:2.7.11.1]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04137  Mitophagy - animal
mmu04140  Autophagy - animal
mmu04141  Protein processing in endoplasmic reticulum
mmu04210  Apoptosis
mmu04932  Non-alcoholic fatty liver disease (NAFLD)
mmu05010  Alzheimer's disease
mmu05160  Hepatitis C
mmu05162  Measles
mmu05164  Influenza A
mmu05168  Herpes simplex infection
mmu05169  Epstein-Barr virus infection
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    13666 (Eif2ak3)
 Cellular Processes
  Transport and catabolism
   04140 Autophagy - animal
    13666 (Eif2ak3)
   04137 Mitophagy - animal
    13666 (Eif2ak3)
  Cell growth and death
   04210 Apoptosis
    13666 (Eif2ak3)
 Human Diseases
  Neurodegenerative diseases
   05010 Alzheimer's disease
    13666 (Eif2ak3)
  Endocrine and metabolic diseases
   04932 Non-alcoholic fatty liver disease (NAFLD)
    13666 (Eif2ak3)
  Infectious diseases
   05162 Measles
    13666 (Eif2ak3)
   05164 Influenza A
    13666 (Eif2ak3)
   05160 Hepatitis C
    13666 (Eif2ak3)
   05168 Herpes simplex infection
    13666 (Eif2ak3)
   05169 Epstein-Barr virus infection
    13666 (Eif2ak3)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     13666 (Eif2ak3)
Protein kinases [BR:mmu01001]
 Serine/threonine kinases: Other
  PEK family [OT]
   13666 (Eif2ak3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PQQ PQQ_3
Motif
Other DBs
NCBI-GeneID: 13666
NCBI-ProteinID: NP_001300847
MGI: 1341830
Ensembl: ENSMUSG00000031668
Vega: OTTMUSG00000031093
UniProt: Q9Z2B5 A0A0R4J1Y1
Structure
PDB: 

Jmol
Position
6; 6 C1
AA seq 152 aa AA seqDB search
MERATRPGPRALLLLLFLLLGCAAGISAVAPARSLLAPASETVFGLGAAAAPTSAARVPA
VATAEVTVEDAEALPAAAGEPESRATEPDDDVELRPRGRSLVIISTLDGRIAALDAENDG
KKQWDLDVGSGSLVSSSLSKPEGTHKTSSKEC
NT seq 459 nt NT seq  +upstreamnt  +downstreamnt
atggagcgcgccacccggcccgggccgcgcgcgctgctgctgcttctgttcctgctgctg
ggctgcgcggcggggatctcggcggtcgcgcccgcccgcagtttgcttgctcccgcgtcg
gagacagtgtttggcttaggggcagcggccgccccgacttcggccgcgcgggtgcctgcg
gtggcaacggccgaagtgaccgtggaggacgccgaggcattgccggctgccgctggcgaa
ccggagtcacgcgcgacggagcccgatgacgacgtggaactgcggcctcgcggcaggtcc
ttggtaatcatcagcactttagatggacgaatcgctgcactggatgccgagaatgatggg
aaaaagcagtgggatttggacgtggggtctggttccttggtttcatctagcctcagcaag
ccagagggcacccacaaaacttcctcaaaagaatgttga

DBGET integrated database retrieval system