KEGG   Mus musculus (mouse): 13684Help
Entry
13684             CDS       T01002                                 

Gene name
Eif4e, EG668879, Eif4e-ps, If4e, eIF-4E
Definition
(RefSeq) eukaryotic translation initiation factor 4E
  KO
K03259  
translation initiation factor 4E
Organism
mmu  Mus musculus (mouse)
Pathway
RNA transport
HIF-1 signaling pathway
mTOR signaling pathway
PI3K-Akt signaling pathway
Insulin signaling pathway
Module
eIF4F complex
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    13684 (Eif4e)
 Environmental Information Processing
  Signal transduction
   04066 HIF-1 signaling pathway
    13684 (Eif4e)
   04151 PI3K-Akt signaling pathway
    13684 (Eif4e)
   04150 mTOR signaling pathway
    13684 (Eif4e)
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    13684 (Eif4e)
Messenger RNA biogenesis [BR:mmu03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Transport factors
    eIF4F and regulatory proteins
     13684 (Eif4e)
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     13684 (Eif4e)
Translation factors [BR:mmu03012]
 Eukaryotic Type
  Initiation factors
   eIF-4
    13684 (Eif4e)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
UniProt: 
Structure
PDB: 

Jmol
Position
3 G3-H1; 3 64.3 cM
AA seq 217 aa AA seqDB search
MATVEPETTPTTNPPPAEEEKTESNQEVANPEHYIKHPLQNRWALWFFKNDKSKTWQANL
RLISKFDTVEDFWALYNHIQLSSNLMPGCDYSLFKDGIEPMWEDEKNKRGGRWLITLNKQ
QRRSDLDRFWLETLLCLIGESFDDYSDDVCGAVVNVRAKGDKIAIWTTECENRDAVTHIG
RVYKERLGLPPKIVIGYQSHADTATKSGSTTKNRFVV
NT seq 654 nt NT seq  +upstreamnt  +downstreamnt
atggcgactgtggaaccggaaaccacccctaccactaatcccccacctgcagaagaggaa
aaaacagagtctaatcaggaggttgctaacccagagcactatattaaacaccctctacag
aacaggtgggcactctggttttttaaaaatgataaaagcaaaacttggcaagcaaacctt
cgattgatctctaagtttgatactgttgaagacttttgggctctatacaaccatatccag
ttgtctagtaatttaatgcctggctgtgactactcactttttaaggacgggattgagcct
atgtgggaagatgagaaaaacaaacgaggaggacggtggctgatcacactgaacaagcag
cagagacggagtgacctcgatcgcttctggctagagacactgctgtgccttattggagaa
tctttcgatgactacagtgatgatgtgtgtggagctgttgttaatgttagagctaaaggt
gataagatagcaatatggactactgagtgtgaaaacagagatgcagtcacacacataggg
agggtatacaaggaaaggttaggacttcctccgaagatagtgattggttatcagtcccac
gcagacacagctacaaagagcggctccaccactaaaaataggtttgttgtttaa

DBGET integrated database retrieval system