KEGG   Mus musculus (mouse): 13684Help
Entry
13684             CDS       T01002                                 

Gene name
Eif4e, EG668879, Eif4e-ps, If4e, eIF-4E
Definition
(RefSeq) eukaryotic translation initiation factor 4E
  KO
K03259  translation initiation factor 4E
Organism
mmu  Mus musculus (mouse)
Pathway
mmu01521  EGFR tyrosine kinase inhibitor resistance
mmu03013  RNA transport
mmu04066  HIF-1 signaling pathway
mmu04150  mTOR signaling pathway
mmu04151  PI3K-Akt signaling pathway
mmu04211  Longevity regulating pathway
mmu04910  Insulin signaling pathway
Module
mmu_M00428  eIF4F complex
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    13684 (Eif4e)
 Environmental Information Processing
  Signal transduction
   04066 HIF-1 signaling pathway
    13684 (Eif4e)
   04151 PI3K-Akt signaling pathway
    13684 (Eif4e)
   04150 mTOR signaling pathway
    13684 (Eif4e)
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    13684 (Eif4e)
  Aging
   04211 Longevity regulating pathway - mammal
    13684 (Eif4e)
 Human Diseases
  Drug resistance
   01521 EGFR tyrosine kinase inhibitor resistance
    13684 (Eif4e)
Messenger RNA biogenesis [BR:mmu03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Transport factors
    eIF4F and regulatory proteins
     13684 (Eif4e)
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     13684 (Eif4e)
Translation factors [BR:mmu03012]
 Eukaryotic Type
  Initiation factors
   eIF-4
    13684 (Eif4e)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IF4E
Motif
Other DBs
NCBI-GeneID: 13684
NCBI-ProteinID: NP_031943
MGI: 95305
Ensembl: ENSMUSG00000028156
Vega: OTTMUSG00000052912
UniProt: P63073 Q3TK95 Q8C470
Structure
PDB: 

Jmol
Position
3 G3; 3 64.3 cM
AA seq 217 aa AA seqDB search
MATVEPETTPTTNPPPAEEEKTESNQEVANPEHYIKHPLQNRWALWFFKNDKSKTWQANL
RLISKFDTVEDFWALYNHIQLSSNLMPGCDYSLFKDGIEPMWEDEKNKRGGRWLITLNKQ
QRRSDLDRFWLETLLCLIGESFDDYSDDVCGAVVNVRAKGDKIAIWTTECENRDAVTHIG
RVYKERLGLPPKIVIGYQSHADTATKSGSTTKNRFVV
NT seq 654 nt NT seq  +upstreamnt  +downstreamnt
atggcgactgtggaaccggaaaccacccctaccactaatcccccacctgcagaagaggaa
aaaacagagtctaatcaggaggttgctaacccagagcactatattaaacaccctctacag
aacaggtgggcactctggttttttaaaaatgataaaagcaaaacttggcaagcaaacctt
cgattgatctctaagtttgatactgttgaagacttttgggctctatacaaccatatccag
ttgtctagtaatttaatgcctggctgtgactactcactttttaaggacgggattgagcct
atgtgggaagatgagaaaaacaaacgaggaggacggtggctgatcacactgaacaagcag
cagagacggagtgacctcgatcgcttctggctagagacactgctgtgccttattggagaa
tctttcgatgactacagtgatgatgtgtgtggagctgttgttaatgttagagctaaaggt
gataagatagcaatatggactactgagtgtgaaaacagagatgcagtcacacacataggg
agggtatacaaggaaaggttaggacttcctccgaagatagtgattggttatcagtcccac
gcagacacagctacaaagagcggctccaccactaaaaataggtttgttgtttaa

DBGET integrated database retrieval system