KEGG   Mus musculus (mouse): 13733Help
Entry
13733             CDS       T01002                                 

Gene name
Adgre1, DD7A5-7, EGF-TM7, Emr1, F4/80, Gpf480, Ly71, TM7LN3
Definition
(RefSeq) adhesion G protein-coupled receptor E1
  KO
K04591  
egf-like module containing, mucin-like, hormone receptor-like 1
Organism
mmu  Mus musculus (mouse)
Brite
G protein-coupled receptors [BR:mmu04030]
 Class B. Secretin receptor family
  Other
   EMR1
    13733 (Adgre1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
UniProt: 
Position
17 D; 17 29.8 cM
AA seq 931 aa AA seqDB search
MWGFWLLLFWGFSGMYRWGMTTLPTLGQTLGGVNECQDTTTCPAYATCTDTTDSYYCTCK
RGFLSSNGQTNFQGPGVECQDVNECLQSDSPCGPNSVCTNILGRAKCSCLRGFSSSTGKD
WILGSLDNFLCADVDECLTIGICPKYSNCSNSVGSYSCTCQPGFVLNGSICEDEDECVTR
DVCPEHATCHNTLGSYYCTCNSGLESSGGGPMFQGLDESCEDVDECSRNSTLCGPTFICI
NTLGSYSCSCPAGFSLPTFQILGHPADGNCTDIDECDDTCPLNSSCTNTIGSYFCTCHPG
FASSNGQLNFKDLEVTCEDIDECTQDPLQCGLNSVCTNVPGSYICGCLPDFQMDPEGSQG
YGNFNCKRILFKCKEDLILQSEQIQQCQAVQGRDLGYASFCTLVNATFTILDNTCENKSA
PVSLQSAATSVSLVLEQATTWFELSKEETSTLGTILLETVESTMLAALLIPSGNASQMIQ
TEYLDIESKVINEECKENESINLAARGDKMNVGCFIIKESVSTGAPGVAFVSFAHMESVL
NERFFEDGQSFRKLRMNSRVVGGTVTGEKKEDFSKPIIYTLQHIQPKQKSERPICVSWNT
DVEDGRWTPSGCEIVEASETHTVCSCNRMANLAIIMASGELTMEFSLYIISHVGTVISLV
CLALAIATFLLCRAVQNHNTYMHLHLCVCLFLAKILFLTGIDKTDNQTACAIIAGFLHYL
FLACFFWMLVEAVMLFLMVRNLKVVNYFSSRNIKMLHLCAFGYGLPVLVVIISASVQPRG
YGMHNRCWLNTETGFIWSFLGPVCMIITINSVLLAWTLWVLRQKLCSVSSEVSKLKDTRL
LTFKAIAQIFILGCSWVLGIFQIGPLASIMAYLFTIINSLQGAFIFLIHCLLNRQVRDEY
KKLLTRKTDLSSHSQTSGILLSSMPSTSKMG
NT seq 2796 nt NT seq  +upstreamnt  +downstreamnt
atgtggggcttttggctgctcctcttctggggcttcagtgggatgtacagatgggggatg
accacacttcccaccctgggacaaacacttggtggtgtgaatgagtgtcaagatactacc
acttgcccagcttatgccacctgcactgacaccacagacagttattactgcacctgtaaa
cgaggcttcctgtccagcaatggacaaaccaactttcaaggcccaggagtggaatgtcaa
gatgttaacgaatgtcttcaaagtgactcaccttgtggtcctaactcagtctgcaccaat
atcctggggagagccaagtgcagctgtcttagaggcttctcttcttccactgggaaagac
tggattctgggaagtttggataattttctctgcgcagatgttgatgagtgtctgacaatt
gggatctgccctaagtattccaactgctctaactctgtgggaagctacagctgtacctgt
caaccaggctttgtcttgaatggctccatttgtgaagatgaagatgaatgtgtgactcga
gacgtttgccctgaacatgcaacctgccacaacactctcggaagctattattgtacgtgc
aactcaggacttgaatctagtggaggagggccaatgttccagggcctggacgaatcctgt
gaagatgtggatgagtgctccaggaattcaactctctgtggtcccaccttcatttgcatc
aacactctgggatcctacagctgctcatgcccagctggattctctttgccaacttttcag
atccttggccatccggcagatgggaattgtacagatatcgatgagtgtgatgacacatgt
cctttgaattcatcatgtaccaacactattgggagctacttctgcacttgccaccctggc
tttgcatctagcaatggacagctgaatttcaaagacctagaggtgacatgtgaagatatt
gatgagtgcacccaagatccattacaatgtggactgaattctgtctgcaccaatgtacca
ggctcctacatctgtggctgcctccctgactttcaaatggatccagaaggctcccaagga
tatggaaacttcaactgcaaaaggatcctcttcaagtgtaaggaagacttgatactccaa
agtgagcagatacagcaatgccaagcagtgcagggcagggatcttggttatgcttccttc
tgtacacttgtgaatgctaccttcacaatccttgataatacctgtgagaacaaaagtgcc
ccagtgtccttacagagtgcagctacaagtgtctccctcgtgctggagcaagcgaccaca
tggtttgagctcagcaaggaggagacatccactctgggcaccatcttgctggagactgtg
gaaagcaccatgttagctgctcttctgataccctctgggaatgccagtcagatgattcag
acggagtacctagacatcgaaagcaaagtcatcaatgaagagtgcaaggagaatgagtcc
attaacttggcagccagaggggacaagatgaatgttggctgtttcataatcaaagaatca
gtatctacaggggccccaggagtggcttttgtctcatttgcacacatggaatcagtttta
aatgaacgcttctttgaagatggccagtccttccggaagctgaggatgaattcccgtgtt
gttggtggcactgtgaccggggagaagaaggaggacttctccaagcctattatctatacc
ctccagcacatccagccaaagcagaagtctgagaggcctatctgtgtctcctggaacact
gatgtggaggatgggagatggacaccctcgggctgtgagattgtggaagcatccgagaca
cacacagtctgcagctgtaaccggatggcaaacttggctatcatcatggcttctggggag
cttacgatggaattctccttgtatatcatcagccatgtgggtacagtcatctccctggta
tgtcttgccttggccatagccaccttcctgctgtgtcgtgctgttcagaaccacaatacc
tacatgcacctgcatctttgtgtgtgtctcttcttggccaagattctcttcctcaccggt
atagacaagactgacaaccagacggcttgtgccatcattgcgggattcctacactatctt
ttcctcgcctgcttcttctggatgctagtggaggcagtgatgctcttcctgatggtgaga
aacctgaaggtggtgaattatttcagctctcgcaacatcaagatgctgcacctctgtgcc
tttggctatgggcttccagtcctggtggtcataatctctgcttctgtacagccacggggc
tatgggatgcataatcgctgctggttgaatacagagacggggtttatctggagtttcctg
gggcctgtctgcatgatcatcacgataaactctgtcctccttgcctggacactgtgggtt
ctgaggcagaagctctgcagtgtcagctcagaagtctctaaactcaaggacacgaggttg
ctgaccttcaaggccattgcccagattttcatcttgggctgctcctgggtgctgggcatt
ttccagattggccccttggcaagcatcatggcatacctgttcaccattatcaacagtctg
cagggggctttcatcttcctcattcactgtctgctcaaccgtcaggtacgggatgaatat
aagaaactcctcaccaggaagactgaccttagctcccattcccagacttctgggatttta
ctgtcatctatgccatccacttccaagatgggttaa

DBGET integrated database retrieval system