KEGG   Mus musculus (mouse): 13809Help
Entry
13809             CDS       T01002                                 

Gene name
Enpep, 6030431M22Rik, APA, Bp-1/6C3, Ly-51, Ly51
Definition
(RefSeq) glutamyl aminopeptidase (EC:3.4.11.7)
  KO
K11141  
glutamyl aminopeptidase [EC:3.4.11.7]
Organism
mmu  Mus musculus (mouse)
Pathway
Renin-angiotensin system
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Organismal Systems
  Endocrine system
   04614 Renin-angiotensin system
    13809 (Enpep)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.11  Aminopeptidases
    3.4.11.7  glutamyl aminopeptidase
     13809 (Enpep)
Peptidases [BR:mmu01002]
 Metallo Peptidases
  Family M1
   13809 (Enpep)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   13809 (Enpep)
Cellular antigens [BR:mmu04090]
 Proteins
  13809 (Enpep)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
3 G3; 3 57.92 cM
AA seq 945 aa AA seqDB search
MNFAEEEPSKKYCIKGKHVAIICGVVVAVGLIVGLSVGLTRSCEQDTTPAPSQPPPEAST
ALPPQDQNVCPDSEDESGEWKNFRLPDFINPVHYDLEVKALMEEDRYTGIVTISVNLSKP
TRDLWLHIRETKITKLPELRRPSGEQVPIRRCFEYKKQEYVVIQAAEDLAATSGDSVYRL
TMEFKGWLNGSLVGFYKTTYMEDGQIRSIAATDHEPTDARKSFPCFDEPNKKSTYSISII
HPKEYSALSNMPEEKSEMVDDNWKKTTFVKSVPMSTYLVCFAVHRFTAIERKSRSGKPLK
VYVQPNQKETAEYAANITQAVFDYFEDYFAMEYALPKLDKIAIPDFGTGAMENWGLVTYR
ETNLLYDPLLSASSNQQRVASVVAHELVHQWFGNTVTMDWWDDLWLNEGFASFFEFLGVN
HAEKDWQMLSQVLLEDVFPVQEDDSLMSSHPVVVTVSTPAEITSVFDGISYSKGASILRM
LQDWITPEKFQKGCQIYLKKFQFANAKTSDFWDSLQEASNLPVKEVMDTWTSQMGYPVVT
VSGRQNITQKRFLLDSKADPSQPPSELGYTWNIPVRWADNDNSRITVYNRLDKGGITLNA
NLSGDAFLKINPDHIGFYRVNYEGGTWDWIAEALSSNHTRFSAADRSSFIDDAFALARAQ
LLNYKIALNLTMYLKSEEDFLPWERVISSVSYIISMFEDDRELYPMIETYFQGQVKPVAD
LLGWQDTGSHITKLLRASILGFACKMGDREALGNASQLFDSWLKGSASIPVNLRLLVYRY
GMQNSGNEAAWNYTLEQYQKTSLAQEKEKLLYGLASVKDVKLLARYLEMLKDPNIIKTQD
VFTVIRYISYNSYGKTMAWNWIQLNWDYLVSRFTINDRYLGRIVTIAEPFNTELQLWQMQ
SFFAKYPNAGAGAKPREQVLETVKNNIEWLNVNRQSIREWFASLP
NT seq 2838 nt NT seq  +upstreamnt  +downstreamnt
atgaactttgcagaggaagagccctccaagaaatactgcattaaaggcaaacacgtggcc
atcatctgtggagtagtggtggcagttggattaatagtgggactttctgtgggtttgacc
aggtcgtgtgagcaggacacaaccccagctccttcccaacctcctccggaagccagcact
gccctccctcctcaggaccagaatgtctgccctgacagtgaagatgaaagcggagaatgg
aaaaacttcaggctgcctgacttcatcaatccagttcactacgacctggaggtgaaggcc
ctgatggaggaagacaggtacacgggaatagtgaccatctctgtcaacttgagcaaaccc
actcgtgacctatggctccacatcagggagaccaagatcaccaagctgccggagctaagg
aggccctctggggagcaggtaccaattcgacggtgcttcgagtataagaagcaggagtac
gtggtgatccaggctgcagaagaccttgcggccaccagtggggacagtgtctatcggctg
accatggagtttaaaggctggctgaacggttcccttgtgggtttttacaaaaccacctac
atggaggacgggcaaatcaggagcatagctgccactgaccatgaaccaacagatgccagg
aagtccttcccttgtttcgacgaacccaacaagaagtcaacttacagtatatccatcatc
cacccaaaagaatactcagcactttctaatatgccagaagagaaatcagagatggtggat
gacaactggaagaaaaccacttttgtgaagtctgtcccaatgagcacttacctggtgtgc
tttgctgtgcatcggttcactgctatagagagaaaatccaggagcggcaaaccactcaag
gtctatgtccagcccaatcagaaggagacagcagagtatgcggcaaacataacccaagct
gtatttgattacttcgaagactacttcgctatggagtatgcgcttcctaaactggataaa
attgctattccagattttggcaccggcgccatggaaaattggggacttgtcacttaccga
gaaacaaacctgctttacgaccccctactatcggcctcatctaaccagcagagagtggcc
agcgtggttgcccacgaacttgtacaccagtggtttggaaatactgtgaccatggactgg
tgggacgacttgtggctaaatgaaggatttgcttcgttcttcgagttcttgggagtaaac
cacgcagaaaaagactggcagatgctcagtcaggtgctgcttgaagatgtgttccccgtg
caagaggacgactccctgatgtcttcacatccagtggtcgtcaccgtgtccacgccagct
gaaataacatctgtgtttgatgggatatcatacagcaagggagcttctattctgagaatg
ctccaagactggataacaccagagaaattccaaaaaggctgtcagatttacttgaaaaaa
ttccagttcgcgaatgcaaaaacttccgacttttgggattcactgcaagaggcaagcaat
ctgccagtgaaagaagtgatggacacctggactagccagatgggttatcctgtggtcact
gtgagtggaaggcagaacatcacccagaaacgctttctgttggactccaaagctgatcct
tcgcagccaccgtcagagctcggttacacatggaatattccagtcagatgggctgataat
gacaactcaaggatcaccgtgtacaataggttagacaaaggaggaatcactctgaatgct
aatcttagcggagatgcttttctcaaaatcaacccagatcacattgggttttatcgtgta
aattatgaaggaggaacgtgggattggatagccgaggctctctcctcaaaccacacgaga
ttctccgctgctgaccggtcaagttttattgatgatgcttttgctttggcaagagctcaa
cttctgaattataaaatagctctgaacttgaccatgtatctcaaatcagaagaggatttc
ctaccatgggagagagtcatttcatctgtaagctacatcattagcatgtttgaagatgac
agagagctgtaccccatgatagagacgtactttcaaggccaagtgaagcccgttgcagat
ttgctgggatggcaggataccggaagccacatcacaaagttactccgggcctctatctta
ggattcgcatgcaagatgggggacagagaagccttgggcaatgcttcccagttatttgac
tcctggctgaaagggagcgcaagtattccggtaaacctcaggctgcttgtgtaccgctat
ggaatgcagaactctggcaatgaggcagcgtggaactataccctagagcagtatcagaaa
acatcgcttgcccaagagaaagaaaaactgctctatgggttagcttcagtgaaggatgtt
aaactcttggcaaggtatctggaaatgctcaaagaccccaatattattaaaactcaggat
gtatttaccgtcatccgctacatctcctacaacagttatgggaagacaatggcctggaat
tggatacaactcaactgggactatctggtcagcagatttacaatcaatgacagatacctt
ggccggatcgtcaccatagctgagcccttcaacactgaactgcagctctggcagatgcag
agcttttttgcaaaatatccaaatgctggcgctggagcaaaacctagagagcaagtgctg
gagacggtgaagaacaacatcgagtggctaaacgtgaacagacagtccatcagagagtgg
ttcgctagcctgccgtag

DBGET integrated database retrieval system