KEGG   Mus musculus (mouse): 13819Help
Entry
13819             CDS       T01002                                 

Gene name
Epas1, HIF-2alpha, HIF2A, HLF, HRF, MOP2, bHLHe73
Definition
(RefSeq) endothelial PAS domain protein 1
  KO
K09095  hypoxia-inducible factor 2 alpha
Organism
mmu  Mus musculus (mouse)
Pathway
mmu05200  Pathways in cancer
mmu05211  Renal cell carcinoma
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Human Diseases
  Cancers
   05200 Pathways in cancer
    13819 (Epas1)
   05211 Renal cell carcinoma
    13819 (Epas1)
Transcription factors [BR:mmu03000]
 Eukaryotic Type
  Basic helix-loop-helix (bHLH)
   Factors with PAS domain
    13819 (Epas1)
Membrane trafficking [BR:mmu04131]
 Autophagy
  Pexophagy
   Other pexophagy associated proteins
    13819 (Epas1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PAS_3 PAS_11 HIF-1a_CTAD HIF-1 PAS PAS_9 PAS_4 Corona_I HLH
Motif
Other DBs
NCBI-GeneID: 13819
NCBI-ProteinID: NP_034267
MGI: 109169
Ensembl: ENSMUSG00000024140
UniProt: P97481
Structure
PDB: 

Jmol
Position
17; 17 E4
AA seq 874 aa AA seqDB search
MTADKEKKRSSSELRKEKSRDAARCRRSKETEVFYELAHELPLPHSVSSHLDKASIMRLA
ISFLRTHKLLSSVCSENESEAEADQQMDNLYLKALEGFIAVVTQDGDMIFLSENISKFMG
LTQVELTGHSIFDFTHPCDHEEIRENLTLKNGSGFGKKSKDVSTERDFFMRMKCTVTNRG
RTVNLKSATWKVLHCTGQVRVYNNCPPHSSLCGSKEPLLSCLIIMCEPIQHPSHMDIPLD
SKTFLSRHSMDMKFTYCDDRILELIGYHPEELLGRSAYEFYHALDSENMTKSHQNLCTKG
QVVSGQYRMLAKHGGYVWLETQGTVIYNPRNLQPQCIMCVNYVLSEIEKNDVVFSMDQTE
SLFKPHLMAMNSIFDSSDDVAVTEKSNYLFTKLKEEPEELAQLAPTPGDAIISLDFGSQN
FDEPSAYGKAILPPGQPWVSGLRSHSAQSESGSLPAFTVPQADTPGNTTPSASSSSSCST
PSSPEDYYSSLENPLKIEVIEKLFAMDTEPRDPGSTQTDFSELDLETLAPYIPMDGEDFQ
LSPICPEEPLMPESPQPTPQHCFSTMTSIFQPLTPGATHGPFFLDKYPQQLESRKTESEH
WPMSSIFFDAGSKGSLSPCCGQASTPLSSMGGRSNTQWPPDPPLHFGPTKWPVGDQSAES
LGALPVGSSQLEPPSAPPHVSMFKMRSAKDFGARGPYMMSPAMIALSNKLKLKRQLEYEE
QAFQDTSGGDPPGTSSSHLMWKRMKSLMGGTCPLMPDKTISANMAPDEFTQKSMRGLGQP
LRHLPPPQPPSTRSSGENAKTGFPPQCYASQFQDYGPPGAQKVSGVASRLLGPSFEPYLL
PELTRYDCEVNVPVPGSSTLLQGRDLLRALDQAT
NT seq 2625 nt NT seq  +upstreamnt  +downstreamnt
atgacagctgacaaggagaaaaaaaggagcagctcagagctgaggaaggagaaatcccgt
gatgccgcgaggtgccggcgcagcaaggagacggaggtcttctatgagttggctcatgag
ttgcccctgcctcacagtgtgagctcccacctggacaaagcctccatcatgcgcctggcc
atcagcttccttcggacacataagctcctgtcctcagtctgctctgaaaatgaatctgaa
gctgaggccgaccagcaaatggataacttgtacctgaaagccttggagggtttcattgct
gtggtgacccaagacggtgacatgatctttctgtcggaaaacatcagcaagttcatggga
cttactcaggtagaactaacaggacacagcatctttgacttcactcatccttgcgaccat
gaggagatccgtgagaacctgactctcaaaaacggctctggttttgggaagaagagcaaa
gacgtgtccaccgagcgtgacttcttcatgaggatgaagtgcacggtcaccaacagaggc
cggactgtcaacctcaagtcggccacctggaaggtcctgcactgcaccgggcaagtgaga
gtctacaacaactgcccccctcacagtagcctctgtggctccaaggagcccctgctgtcc
tgccttatcatcatgtgtgagccaatccagcacccatcccacatggacatccccctggac
agcaagactttcctgagccgccacagcatggacatgaagttcacctactgtgacgacaga
atcttggaactgattggttaccaccccgaggagctacttggacgctctgcctatgagttc
taccatgccctggattcggagaacatgaccaaaagtcaccagaacttgtgcaccaagggg
caggtggtatctggccagtaccggatgctagccaaacacggaggatatgtgtggctggag
acccaggggacggtcatctacaacccccgcaacctgcagcctcagtgtatcatgtgtgtc
aactatgtgctgagtgagatcgagaagaacgacgtggtgttctccatggaccagaccgaa
tccctgttcaagccacacctgatggccatgaacagcatctttgacagcagtgacgatgtg
gctgtaactgagaagagcaactacctgttcaccaaactgaaggaggagcccgaggaactg
gcccagttggcccccaccccaggagatgccattatttctctcgatttcggaagccagaac
ttcgatgaaccctcagcctatggcaaggccatccttcccccgggccagccatgggtctcg
gggctgaggagccacagtgcccagagcgagtccgggagcctgccagccttcactgtgccc
caggcagacaccccagggaacactacacccagtgcttcaagcagcagtagctgctccacg
cccagcagccctgaggactactattcatccttggagaatcccttgaagatcgaagtgatt
gagaagcttttcgccatggacacggagccgagggacccgggcagtacccagacggacttc
agtgaactggatttggagaccttggcaccctacatccctatggacggcgaggacttccag
ctgagccccatctgcccagaggagccgctcatgccagagagcccccagcccaccccccag
cactgcttcagtaccatgaccagcatcttccagccgctcaccccgggggccacccacggc
cccttcttcctcgataagtacccgcagcagttggaaagcaggaagacagagtctgagcac
tggcccatgtcttccatcttctttgatgctgggagcaaagggtccctgtctccatgctgt
ggccaggccagcacccctctctcttctatgggaggcagatccaacacgcagtggcccccg
gatccaccattacatttcggccctactaagtggcctgtgggtgatcagagtgctgaatcc
ctgggagccctgccggtggggtcatcgcagttggaacctccgagcgccccgcctcatgtc
tccatgttcaagatgaggtctgcaaaggacttcggggcccgaggtccatacatgatgagc
ccagccatgatcgccctgtccaacaagctgaagctaaagcggcagctggagtatgaggag
caagccttccaagacacaagcgggggggaccctccaggcaccagcagttcacacttgatg
tggaaacgtatgaagagcctcatgggcgggacctgtcctttgatgcctgacaagaccatc
agtgcgaacatggcccccgatgaattcacccaaaaatctatgagaggcctgggccagcca
ctgagacacctgccacctccccagccaccatctaccaggagctcaggggagaacgccaag
actgggttcccgccacagtgctatgcctcccagttccaggactacggtcctccaggagct
caaaaggtgtcaggcgtggccagtcgactgctggggccatcgttcgagccttacctgttg
ccggaactgaccagatatgactgtgaggtgaacgtgcccgtgcctggaagctccacactc
ctgcaggggagagaccttctcagagctctggaccaggccacctga

DBGET integrated database retrieval system